SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM343790-PA|EEB15025.1|Rho from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM343790-PA|EEB15025.1|Rho
Domain Number 1 Region: 1107-1302
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000643
Further Details:      
 
Domain Number 2 Region: 912-1040
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-17
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Weak hits

Sequence:  vb|PHUM343790-PA|EEB15025.1|Rho
Domain Number - Region: 796-825
Classification Level Classification E-value
Superfamily WW domain 0.00983
Family WW domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM343790-PA|EEB15025.1|Rho
Sequence length 1303
Comment GTPase activating protein, putative|DS235346.1:100962:107504:1|gene:PHUM343790
Sequence
MTSKVFHCIPVNVACWLQDIRYTAEDYYDYGIEWKYHYYHRVWKNEEENSSNESIYDNVD
RNDFKTKRGEETNDEKVIETNKSSSLSSPLAEEIVFDDVIFAKDFFSKSECPTWPMRKFS
KMQDRRSSLKNILEYILFKLKMIKTILNLSDIIYGKDFGEFVREEKENGKTDAFMSNLLA
SYRDRHIRESVWTWLNDLPGLLTPHKPDFSGFLNVGISADKPPVPPKRKKRKTTQWNRCR
FVTPRRRRHAKKLNYNSVKGKEIAGKITKTITNNNNNADSSTCSDHFSNDKVESGEKSNL
LLLPYDVLKFEMNNEDVVDDNVTAKPLPFPLPTPELEFEINELLMMQRVTESSKTRRLRR
RCMPLESKGPFLDKSNDIVEYCVKDIPNALPAQLSKRSTKESFLANEMSNVNLKKIFDKL
SREMIDAESQKKVETFLKSKFLNKNVEYLSELKTVKLREDVIIDWENDYENLNEPVILEG
KSISPKGANDRSGKYWKNGVDDDDGDRRISWESATETCVSRTESFSQYENVKQSSNEYME
KYLQSREESESLCGNNNNDNKYQECETVPSISSSKTVADTSTTTKTHKTSLQVILSDSND
KFTEDSGKLKSESETFDKISITSDDNNSFSDFDSEYSESGATPASGVLHTSWCNENDSLT
SLTWELSSQDENDERREDNEIHNDYHDYRPLSYCSTVESNFSDSDSTLKSSYSGKIFPNE
TRVENKKENEEVKFHDKSRVNDKIFRSKSLDFFRDSLTESRCRGRRRFDRLRDRNSVRSD
VCDWMAKIRGIVLSEDDEWILSFDSEERAYFFEETSKKSLWALPDYSISENSKPEFNYSI
QRSATESAIIPHENETKLRQSKDGDKNNRISASVRSSKAQSMLIEPKFDIPANNGNKAFS
MPRDLTKIYGEIIYFGVLNKTKISENGKKLRKNWTPAFAVLTESYLFFFKDAKSFQNMKN
VVGVSNNHMCLNLQGALIEKGDKISSRKNVYKISCSDNTDVLIQTEKTAEADEWFKEISL
VIQNLPPELNPPPPPSSSSPLFDLSSPSKVVGRTKSLKVRTKDNTGSMEDLSSTSEDRQN
KIKAKLKKFFIRRPTVDSLKKKGIWKDEPVFGCSLEQITKNRNPRVPVFVEKCIECIESK
EENMKTDGLYRASGNLSQVQKIRLEVDQNNLNIMKDEEDVHVLTGSLKLFFRELKEPLIP
SKQLEPALLATDKQGRKERIKDFQKIVKSLPTPNYDTLKFLLQHLLRVKEYHKFNRMNIN
NLAIVFGPTLMWPEQESANMALELMQQNVVIECLLKEYQEIFT
Download sequence
Identical sequences E0VNR9
121224.XP_002427763 XP_002427763.1.24195 vb|PHUM343790-PA|EEB15025.1|Rho

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]