SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM347560-PA|EEB15085.1|Engulfment from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM347560-PA|EEB15085.1|Engulfment
Domain Number 1 Region: 550-674
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000193
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 2 Region: 98-267
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000155
Family HspBP1 domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM347560-PA|EEB15085.1|Engulfment
Sequence length 726
Comment and cell motility protein, putative|DS235354.1:291443:294377:-1|gene:PHUM347560
Sequence
MNTKTVKMPALKDSNVVKIAVEMDDQVPQLISFNQKQPLAAIIQDLCNGWGLSEPELYAL
QFSENNNENYITEKNRNEVKNGSVLKLTFSPSKTAHDILTKLNGTNTEDKTSALQKLSSL
STDITFALEFINKQGLALVISLVEGGKCKGNVLAYSLISFVELMDHGIVSWDVLEIPFIN
TIASYVNNQSEAQDFKVVQSSLSILESIVLNSSAKYGLVEKEVTVPNLVMHLQSQHLVIQ
QNAIALINALFLKADAAKRKVISGTLTSKQVRNLILTNIIQSNNQVGAEMAHQLYVMQSL
TLAQLESRMNTKMDLHDIDALEKIKELRKIAFDMDGNNLLGDTSTLRQMGGFAKDYKKLG
FKSDINPALDFTETPPGMLALDCMVYFARNHVDAYTKVVLENSCRADEHECPFGRTSVEL
VKLLCEVLRIGEPPSEQGQNYHPMFFTHDHLFEELFCICIVLLNKTWKEMRASTEDFVKV
FSVVREQITRALASQPFGMDKFKAKLSTLTYSEITNLWQQERTSREEWESHARPIVQLRE
KITPEIIDLIQKQRLGFLVDGTRFTKYSSRGQRIKDKFWYVRLSPNHKVFHYGDCDEKNN
PALEELPNKLAVIDIKSLVTGKECPHMKDIRGRKTTHTLAFSLLSDSVEVSSLDFVAPDE
QVFDYWTDGINALLGNKMLSKEAENDLDTLLSLEIKLRLLDAEGLDIPQDPPPIPSPPPN
YEFCFE
Download sequence
Identical sequences E0VNX9
121224.XP_002427823 XP_002427823.1.24195 vb|PHUM347560-PA|EEB15085.1|Engulfment

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]