SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM351440-PA|EEB15143.1|lysosomal from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM351440-PA|EEB15143.1|lysosomal
Domain Number 1 Region: 2325-2616
Classification Level Classification E-value
Superfamily BEACH domain 3.4e-110
Family BEACH domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 2711-2970
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.89e-24
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 2221-2319
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-19
Family PreBEACH PH-like domain 0.012
Further Details:      
 
Weak hits

Sequence:  vb|PHUM351440-PA|EEB15143.1|lysosomal
Domain Number - Region: 1563-1737
Classification Level Classification E-value
Superfamily ARM repeat 0.00518
Family Exportin HEAT-like repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM351440-PA|EEB15143.1|lysosomal
Sequence length 2983
Comment trafficking regulator, putative|DS235354.1:661906:674929:1|gene:PHUM351440
Sequence
MCCRAKLVLMRQSSFSCLKSVKFAMENLCSIQFGSLYTPVLNYQEITHLRLGLTQLLIKS
LETALTCTETTTNVLVIGTLPMMLKVLEDSESLNECFENRKHHQIIFELIRSVINFLFSL
LMQSFEKERVNQFLELFKIFIESHNGKLIEKTVVALIKSNNIIKAKKVIEMIGHLISALK
RMRKEILSPEPFKKQKHKKYKNEKTLYHHQDLFGIVFTAPAVGSNHPQNCCISSLFLIIL
ELIKLPSQKLKILVFHLLENTLYLELGYYSVPQNKKLTCLICFKRSLEEKKSILENKNKN
QNSASPKFYQSPNTNSENYFFELYNETNKNPSTKLELFQSLLLSNEIRIVQGVSNHLLKL
FLISKDEFFVRKDEISSFRILSSLSMFSLLVNDVLFARKFIDQNGLNHVLELVTVRSFTK
SCCAVFEKTILHIVTIPNITVEYLSPLASLRNIVNSANTVLLNYFNDLKESHGMNVLNAS
LTQKKRKKKQENIQQIIDILENVSTYWKTYSNLSMYSLTLRKYFSQENILMDCNKLLKIS
LLSIANTFDSDQNLLMDRKKRLEIFLFIRLIESLLTFVLSISHEENKKKETESIIDGLSE
FLLINNLQHFHVRTMAEVLIKCSLSQPNRLFLNSSSYKNTKDILDVEDDEKIFTDSESLD
EYYVTADEGYEADVEIRENFSNSDDLTNSNSCYQTFDSSTQSTIKDSIFEKHDQKNGCLI
IFPKLTLLAIDILIKSFQQMLTIDNNSLEKIKNTELNSSETVWKKIVNNNEMFKDSSIFS
EDNYDMLEKIYETNNLFGKAKCDFQEVKKKEKNYEKKCLTNLILVLQRLTQLCKNQPKNC
GILCENNTILKLLYGFELCFMDNKNELSELQTAILELVTILGRHSFTPEDLFIYFSMISS
WSLFAISLSIGPELNWSVWNQGFSLSLWLKIEKKSINGGYHNNFKSKTTEKTSVKVFKAE
SLGSVCSTAGLSGLSDFCSNDFFQFSPSSISPQELLHIFSIGNDSLTLECWSVPDLELLI
WRLTKLDDQKKYKILSENYTNRCLPLFIWNHLALNIKASFSKKKNVVDVTLIINGGNEIV
VSLSHTGPSLKKNHPFSTVLLGMESNYTQGVFSFGSLMLFTCPVFTRETAVYFLGLGPNC
ANLTDCIISRRGLNLTSIFSAKSLISDINWDEVLNSNQDVIKKAQSHLLLVYSAYNPKIF
TVYSQVGDNSSSLLLSGFRLKSSEKKENQRMAISLLSNINVPIDIHKHQGFVPSAFIQGG
SASFMFLLGRAVEITNDPEVQSKFLFLLLKFVQTDCDLFTQFINNKHHYMLHKIFSASKS
LSGLHILKTIMEAGCDKPIIDNHDGGFHIINNMDSIIVNSFLIASILSSWKDLSSKLQEN
EVLELFLSALLALTRDDHPYREFNVAQLNRVKLIQCLLSFCKACISFVELIKSLLGAPPE
LSHVMALMDCLILLHPVDSTYITNDKTSFYFLISFNQTYGRNSENPINNEKREEDISNIL
KYDLHRLLNRELSNFDLNKTKKLENRNPAKIIFPNMLNCSPSESKEEKNNHQISESTCTI
VEGLLLLLRNTILVLPDSMAQHVLNYVVKPEILLVMANHQNEKIRSAVVKVFSSYFERSL
DENVSRFIKQRGFYHLANQISLFPASQELAENCLHLLAQRYISLDQPVIISKCELKMFRM
NFLPPLLALIPRSVHNPTLTQNLISIIQQLFNKDNETSAFLLEIGLLEIIIKTLVCSAHF
DCINGRQNILTSNLFHFFAYIINQSLITSGMTFLQIFSDVRFQLNYALCVEKKKCGPQSL
CVKIIRDTWCKILEKTIETLRNLIGSLQLFKKSRPSNFSVWIGNTNDSSGSELEQNSSSI
NNSSKILSSSHGSVREISKNELSERFRILIESSIEFLIFSSRLSIVLSDIELSFLYHLLP
MLLQILSCSERQTQIRCRMYHEIYHAIGETLKTEAFELILWLLSPQQALKIRMFALTTLI
SQPSCKNLISVLLQTSGQAELKFTVFIWDLMHKSDLLSGDVKNCQQIIEWMRERGVISPH
LIESSENFWKESCNSLLSENTKRGLLWEKQIKMKAYKCMGKHNFLVRSLIQDADTMTRTV
VDFQNVVRKSFIEEIKHYCIDNVNVILKWKKLIERLSHEKAVWHFPKSYPAFWQLDPTEG
PSRVRKRLMRCHLKLDEKYLLPAERHKLSYEKFSQPLEFLFKEQAKNYQSMVLIERLHCN
EKIKNMFSANIITPAIEISGELLIGETCIYFVPDNDHKFQTINVLNTVWPFEDITEIHSR
RYELQERGIEIFLQNGNTYFIALKTSKERNTFLDVISTCDLPNKVIGDNLSETMQMWREG
LITNWEYLTFLNKIAGRTYNDLMQYPVYPFVLSDYTSSTLDLNQKNIYRALEKPMAVQEK
KNELHYVNNYNELLGGVKQATLNKEPYHYGSHYSNSGTVLHFLVRLPPFTKMLLHYQDRN
FDLPDRTFHSLHTTWRLASSESTTDVKELTPEFFFLPEFLINSQGFNFGIRQNGEVVNNV
FLPPWCKGDPRKFILIHRQALESNYVTENLPRWIDLVFGFKQTGKAAVDAINVFHPATYS
GFDLEAITDPVERIAWETMVKTYGQTPKQLFKTPHPMPIRSLQNSDSISHLSLPHLTNAY
SYGYNYKEVKGLKWGYFPGSPNESEPVILFRQPSNTKEIISYLAPLPTNDIIGIPDNTTC
LLHLSKNKEGWNFNGCRIALISWGYSDGIIRIKLKNESPMLPLYTISLLDPVTICASELG
CNNLWMGHSSGNITVYKFKFASDQDHVKFDDLPIALQGHKKSVTHIAISRAYSLVATSGL
DGIIIIWDLNQISYVRSIDLSQGIVNMAVISNTLGDIAAVVESNKNSHANMLYLFTVNGN
FVNSTTVKESISCVCFSSSPEGTSINVIACGLKNGVIRIFSTWDLTKLCDIFIPSMTQPI
TCVTYSYDSQFLIASFNDGSVVLWQSTNNKSKLKISKLLNLKL
Download sequence
Identical sequences E0VP37
vb|PHUM351440-PA|EEB15143.1|lysosomal 121224.XP_002427881 XP_002427881.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]