SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM351790-PA|EEB15158.1|4.1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM351790-PA|EEB15158.1|4.1
Domain Number 1 Region: 116-227
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-24
Family Second domain of FERM 0.00086
Further Details:      
 
Domain Number 2 Region: 240-334
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000172
Family Third domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 24-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000434
Family First domain of FERM 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM351790-PA|EEB15158.1|4.1
Sequence length 1322
Comment G protein, putative|DS235354.1:753088:759941:1|gene:PHUM351790
Sequence
MRCSSTVSAPVQHCCAPLTAHHSRYIAVQLLNNQILYFVIQTKSKAKDVYSQTCSYLKTK
GMLNCELFGLAIMYDQEYLFVDLECKLSKYAPKSWKSSSSRGLDAQGKPIFQLFFRVQFY
INIPFLLRNDITRHNYYLQLRDNVISRGHVVFCSGDELLLLLAGLALQADFGDYDKLECK
ENYFQLDKYFPQELIKRNSNLYKTAVTLHKKHRGLTIAQAEMNYIRESSSNELTLLNHNV
HLYKLKSNKKLHDDQDVVWLAISAQGIQICEDTLFKKSLLATYSWDSIGKLCFDKKKFEI
NSSKLEKMVYYTSSDEKSKHLLFLCRVSHQFSKVSDLIFCENIKKQGGSHSSVKKEKFCI
ATTTSDDNNIFCKDSPYTEPNINDSASDDNDLSNKRLVLTDFNREKTKYDSKIKIKTSKK
NCKHSCDNIFLNKSMNTENLKNELTDEASRDEARKKNDKHISSELVYRLKNINNVETGTA
VNSNDLKLLTRFSSDSNLYFSFSDDDTDTNSDSNTYCRNKSKKNFKKFSLESGIFQNSIE
RLTFTKKKKKKDLKNEERGNNIEETCAESTKSFENFPRDEKKVFFKTDGTHVEDFISEKK
NHHSGTYPSCPSISSNLDSDSDYYVMLPVRNTSQKIENEKNFSSLSLDFTKCSSKKSLEP
DKFQPDSNKFIPLEKLYLKNIFSPPLEKNKISCSYSSVVDDSIQSVNNTTNVSCYKRSIL
LPRDRAESSNSVKTDATRRGDSYFKNLFMNRCRNINGYQLHEKDRHDPPSSQEYCVTNEK
KIIRELGDIASGKNKNIIDENSRLTVPIIIGKNNYLDIHATKANDNAGKKDAMIHQKYSS
VSNNQFPKKWSSATTVYTSQIFRSQIEQYRQQLYSDVDYVIYPMKDPAISKREYLNAKQG
SFLSALASEYTYGYTKSPTPSLCARAETRTQCKQIENSNFIKTHDSFEKARNTISNRGRV
KVQINHSNKRVLEFQECLQRTSQTKSIHAVSSNVIFDRGPFTGSVNGTECTGSLSSLNIP
KNFTHFTRVKSDDKILNFHDGRNILNENSKKCQISSPDALFIPHSAWVVDAKRGSRKVSD
SKTQCKTLCGTRNLSDSTLSRDKYKSEKTVKCDDLNGKTILSKRISHYSNKNDKNKQIDI
HTLIQQSKNLDLPLISALCNDKTLIQQTNAFVMPKHPSLKRRPRANKSIDNSRINSSFSM
SKNFNDATAHHHHQILSNKEKLKKKNPNESNSEVTRCGKKKAVVKKEVNASTTFLDSLLS
IKVSKKSISKMKYPVSGMSTTQISRPQKKLSSSHVHPLGAVRTVKNHHALPVPSNRKYDL
VP
Download sequence
Identical sequences E0VP52
vb|PHUM351790-PA|EEB15158.1|4.1 XP_002427896.1.24195 121224.XP_002427896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]