SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM354410-PA|EEB15192.1|transmembrane from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM354410-PA|EEB15192.1|transmembrane
Domain Number 1 Region: 24-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000369
Family RecA protein-like (ATPase-domain) 0.051
Further Details:      
 
Domain Number 2 Region: 170-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000047
Family Selenoprotein W-related 0.014
Further Details:      
 
Weak hits

Sequence:  vb|PHUM354410-PA|EEB15192.1|transmembrane
Domain Number - Region: 34-54,380-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0183
Family Nucleotide and nucleoside kinases 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM354410-PA|EEB15192.1|transmembrane
Sequence length 646
Comment protein, putative|DS235357.1:230777:233728:-1|gene:PHUM354410
Sequence
MNKISAESGFQLLYRFNEKPSLSDLDNILFPNGLKGGDIVQLTGESAIGKSTLLLKYLTK
SLLPKYYNGVFLGGLNVGVILIDTSHGISILKLVCLMEKFISQTCECLTKSESIEILSNP
DNVKDIVNNSLKNLIILKTYTSLQLEMNYYSIEKILATDSKSSMIIIDKLSAAIKSTCPS
VDVASKNGSPGSFEVSINGELVYSKLRTMAFPDFDSVLEVVKEVESGEFPRKIEKQQPIT
NFMRYSSKFFIKILLMCLVIILICLSYNIYLTAENSFNKSSTLLKKTKSVKIEKIDMGQV
KLFNNAENSFEDMYNFKVDLKFLRKKKSNNNNLKKQYSKHEIEIWGKASIGDYLWNHILD
GNSTTYANGLIKHGEIKIQNLLFRFRSGPGIVQTTVPTSVKNLILVLNGKDDVKIKFSKN
WLDYLIHFKNLKNVGVVLLGDEKCDNNWILQYLKTRGGLVDFVFLIYDCKLIDNREFYQW
PLGVATYRGFPLLKLNHVNVDVARQHLCSFMGTVYKNSTRVLLTQILKKSNKCFVASRDN
WVPGETYESMSRYLKKLSDSDLTLNPVGQNTECYRIYEALSLGTVPIVENVVTPGDCDSG
KNSPLRLLKEHNAPLIFIDDWNDLNSVLESERGKKYSNGTMILKGK
Download sequence
Identical sequences E0VP86
XP_002427930.1.24195 121224.XP_002427930 vb|PHUM354410-PA|EEB15192.1|transmembrane

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]