SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM363880-PA|EEB15377.1|KH from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM363880-PA|EEB15377.1|KH
Domain Number 1 Region: 100-199
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.15e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM363880-PA|EEB15377.1|KH
Sequence length 248
Comment domain-containing, RNA-binding, signal transduction-associated protein, putative|DS235371.1:206833:208079:-1|gene:PHUM363880
Sequence
MASVDINGLISKTHENKESEICGDSDCSKYDSEDSRYDSKTLAYIESLVKEKHNLSTGTY
PNASRLLDEELNKTKQSGYPSRDYRYIDIFREKPVKVVVKVLVPCKEYPKFNFVGKLLGP
KGNTLRRLQEETMCKMIILGRGSMKDKTKEEELRQGLDPKFSHLSDDLHVEVSTLASPSE
AHGRIAYALKELRRYFIPDANDEISQEQLRELESYELMEGNGDSESKSRTKTQTAFRGEV
NTLFYIHI
Download sequence
Identical sequences E0VPS1
XP_002428115.1.24195 vb|PHUM363880-PA|EEB15377.1|KH 121224.XP_002428115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]