SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM363890-PA|EEB15378.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM363890-PA|EEB15378.1|conserved
Domain Number - Region: 1221-1306
Classification Level Classification E-value
Superfamily PapD-like 0.000124
Family MSP-like 0.028
Further Details:      
 
Domain Number - Region: 4176-4237
Classification Level Classification E-value
Superfamily PapD-like 0.0012
Family MSP-like 0.0068
Further Details:      
 
Domain Number - Region: 3259-3322
Classification Level Classification E-value
Superfamily PapD-like 0.00576
Family MSP-like 0.035
Further Details:      
 
Domain Number - Region: 2742-2795
Classification Level Classification E-value
Superfamily PH domain-like 0.0154
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 
Domain Number - Region: 160-228
Classification Level Classification E-value
Superfamily PapD-like 0.0445
Family MSP-like 0.031
Further Details:      
 
Domain Number - Region: 2896-2943
Classification Level Classification E-value
Superfamily PapD-like 0.0863
Family MSP-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM363890-PA|EEB15378.1|conserved
Sequence length 4772
Comment hypothetical protein|DS235371.1:208668:229389:1|gene:PHUM363890
Sequence
MELLPNILNVEKENFMLTPSEFNKEMNLTTEERHKFLQSIPNNKAVFKNNYPKQLRIIPQ
IVVFQKFENRSTISVILQIRNVGNTSLPIQINCPPSLYFSAVPAGTPIHKLAPGLAAEYK
ITFTPNEKIDYSHSLEFRCKNENFTVPIVAIGPRAILDIPNQITVNPSPIKLAGEKCLVI
RNIGEVPASFHFITKSPFKVNPVKGFLNVQESLLLNVTFESAKLGEVTSKLYLILETGEK
LTVMLHGSAENASIRLEKNSLMYEDTFHGLKRCKTVRLFNNSSSVVKYSWKKNKFLEDDK
TMIENLREKYSDIAELEIIKDTKTQFFNLGDAERHKLLCERILQDECLILEKEEFSFTNK
AFKITPLKGEIWPRSHVEVTVTFEPKECKFFTAEAYLEVSGRENRLSLQLKGQGLGPKII
VSPSTLDIDYIIAVNKGDIPGRIDYKEENTIFGGKLEVTPHSRYLNPEECGGFLVTFTSN
KNGEFLEKLTFIIAESEEPVTFVLTGKVVNPVLHFDKRGINFETVPFGTPTVREVTISNL
SVVPVTFSLVVLSDGRYPSISYNTFASAKIKPSVSDFPKEFQIEPRESVVEPFSCKKLTL
TANKSGAFSTHLKMNMWDSETGSVTCPITYRCVIATIKVLPESINIPFCFVNFPYTRTLA
LTNVSKVSGFFYIVPLDPFLEENVTYSANIPQGIIQPRETIKVDITIITSAVGWQEIPIN
ILVFGNDRYHEVSKIYCTGQGPVVTFSANSLNWGEIPLLEQSRKFLDFSNDSPIPASVQI
YLVKGDSPWSVTPSTFTLASAEVISIPIDLFLNDRGKFKDTLKVSVHNGKISSISLSAFG
IGSSLAMTPKLTPAHEIGTLFSRRKYEFEILVENRGVKPYSLIWSPYEELSDFQFILEPP
KADILPGQCVKMYLIAQSSSLGYFEQKFYCFASIALSIRELLFTSVISAKFVEPLIDFDK
NKLQFWYNVGFDGIEKHLEDKIQIKNLSELPLCMNIFIAHHFRINMNDDSLTDSLELYLN
SQEKQTLKIVFEPQMNSKFLSRTYSEPLKVTFLEHFKKFEIPLTGEVNYPNVFLLPKVVD
FKYVPLSANYCQEIYIVNVSPLTVYYHIAWNVEKCNIECPNIISKNLIEYEGTEEENYSE
IFGETSCEFFSNELTNAYRTTRSSDTDDEGRNLPECIRVCDIIPFKGKLEKFSSQVLLVT
FCPNVIANYHIEAKVQIKSGPTETIKINASPESKTLKISNHGNMPIDFEVNEDFLPISKE
CDQNYGRVIVNPLVGTISPFSEVDIKITYQQRYPGFFKKKFTIQLDCLDLEIITIYGEAT
FPQVYIHLPRPALAKVPPEIAYFSVSNITPDWYLSSKSNFSCGEIPDVKPYRSQESQISN
FLSCEDSNDSESDWEIVGEKENGLPPAIDLELAIERALISTLIKQDNKPNAGMFVRSIPD
FIVPEYEKNLNVVIVGRIVDEIIEISNFGPFPAVIYSKIDSDLKECGLTLKLRNRREIST
GNKFSIALKFAPKKSMYPDIIINIEKFFYLEVYYGPIIPIKITATVTYPHITPSLYAINF
GIVECGCCRVLNLRLKNPGLVPAFWSISVFKKNSEVYLRSTNNYVSETRIFNVNRNSGVI
YPNEYNTVQVSFRPDEFQSLILVQTSEGLNDLKIDAFGKGVEPKLKISDKKFLFGPIIPY
PNKSEKYFTIENPCDFPIEIYFPAYDEQIFEEDKILRAVCAYYQTPEILLPIRKPGEGLP
IELINFYQTLLENLNNHFQGDDELPAIPPSEENSYLIPTNSDVPIYDTPKTSSQFSNNEK
KKLFSTSKSNSKQRMSFISSRLTIPDNMDGSIQTLFQAKTSAEIEELLQKYIKTLTKSEL
KHDPIQSAIKAIVPPPPTEEYTQGLLIIFHGAPFTNCTQLSNQAALTANLKAKGIDQLIV
EEAALGRCKAGITAKQLIEEAYHTYLDPKSDTTSKCEEESEIDSGNKTYEELLEKFEAIA
ALKYADNKMTSARSHSIKSESSRKDKSIFLKPAIVYEPLIDIPGELIAEILKFRLSIELP
KGIVIQDLNSIFFPTPTTALITLLEAAGNVADIIVVILLNNYFQHNSNILKVQLEKENEK
LEFQKKLQCILEEEGEEEIKPPRFLPYEDKYLTEDEIELGITTFLNRRKGTAEKKKNLEK
SGKARDESSRVESEEKSNALENDFIDFNQELSEIKFLIENWDQRITSPIADNIPDNKSIK
KMSKISDSISAKFENPPKGIHLWMVDLSRPEKNLFSRVCCHLKTVLEQRYVPEESDSWPL
AKTDGLDFAVVHCPQLRNRPILTPIFTMAIAEPNVTESINIEDSLTTLMEIPLASTQITA
RSASQMSVRNKKKGSGSLKQRKLETRNSMGSKSLSQRNISSKIESSVFKSRWVLQPGDII
TCRVKYFPEEVGVTEEEYWISLVNWDTKYVVSCKGICEIPRIDMTPEVIFPLVYEIPPVL
EPVFCAYFYNEDAFNFGQIIFLQTFNDCIVFEKKTEFTIKNISLHPVYLEIILNDDNSSE
TNVKWPHLQIDTNTLVLLPQESKKLGVTARPNKVGPVVENLLFAVKNNPKIEKITVKFEG
VKPSIRVEPKSINFDKILLHRRSYRQIVLINETLIPLYVKLSDFRKLEHNFEFSMTHCFL
SPGGNRTIEIYYSATEVQTLVNEPLLIEVFNEPTSNILLQQIILPFSVEAYDVALDIIFS
KKNSDHIDLGNIRAHSDCTEILQLKNAGKYVLDYMIHIDEDLFFVLKDDYLSVTPTEGKI
MPEKSISVTFCINLKKEIEWKRENLFSIIVLEPNKGNELIAKIPICVSLNSHLPSYKISP
YPEFNFGYYKVDFTITEILHFTNNGYFPLSFTFEVKDGTLETVDNKVKKPTKPTASSKGL
EDKVKKSLVPVNFGPFEIFPPSGIIEVGESFEVQVTFSPKEAKIFEENVTIKFTQSPSAL
ENVNNVILKGEGCVPDIDFDNHKVTFREHFIFESYTIFTEEENLFSFKNACLCKTMEARI
HLQNLGFIENHVFANLTETNRKENESAEPEIFTLSPKELIIEPYNFGTLTITFRPEAIQE
YTGQLMITLEMPRNIGDKIKIFNLYGNGVLPQIEIVEPGTKLPDGSTLVNFLPINPNQNS
KTLISFTNSGILSCKVVVEMYNNEDKVYTLIPTEKTKEMLKAWETKKPIDHTVIVSTKPG
DVVEFMVSFTPKEVKTYSSKIKLFSIDNPFENLTYKLTGDGFFDDVIIEKIRKSIPFANE
NDFDSTSSVCTSPGHYSLTFNDCFVKKKSRVLLRLSNKTDKDYFKFDWDEIQNIIVSPSK
GFLYPNSFKEILIIFSPDEPVELDDVLLNCTLNKILFESLPNLSTSAHRNEKQNTNEEEP
PHEIIPETTRVLALSLSGNADYARLYCETTHVIFKNTFMFQTRIQTVTLENYGNVTLEYK
LTVTSVKTRPLKNNKMEEEEKKIISSLEKPSTSPIQTIRNCLSSRTSLMDLKSENKNEMK
IVEDLKPCPYNPFALENSYGLIPPRNKTNFNIVFSPMDVNEYTAILKMQIPSLHPDCKVP
EIILEASSTMPYCHFNVPESDYLESGRRDFSRPGPIGCAPGLPLDPDTKTIEVKVLGIGH
TVPIKFYVINPTENDYTFSWINSTQIQPDSIQTFYCLTSDGRIQAGRQQQMHFNFVSQKI
GLFESFWKFKIPEHEVETLFLIVTDVREPSVYFLSSHVVLKSTFIGSTSDDFLTLVNNEN
SSFDFHFLNDSIYSEGRTNYLTVEPMSGKISQHSELNIKISFTGKTGGKNIFYLKCKVKG
IKEIFTVAVEAMVYVVKPIVFFEDFNNVKHRVNTKKNNVIDFGAELTPNRPESITFVLTS
VSKILFYYDWIYDKKILESHSCRIKLSPKNGHVLSFSKGKCILSLVFFKKSSLINFPLKL
KISKGPSFNFLINACATTPTYEFSFTTYDFGYCFLQERDTCYYQVPLFIQNKDVIDLTLE
CFFLTESNAFTFSLPYPTIKPNEKIKILFYFHPTKLIVYDEKFKIVINSFHERLIRLKGQ
GTKFKVELKDTEDAIISLGAVKAGKNVKRKFSLINKSLASANVLVGFSDQLPVSGSYMAK
SDENFIDLSVDHRLSDVLTISPSTLFKMKPQETFDVTVTFSPKVKTSSRFSEMVSIQHQD
KAEPLCMIEGCCIGPEICLDRTLINFGAVVKNCKSVLKLKIINSGSEGAKFKWDTKNLNK
DFEIYPESGYCSPDAAVTITITFFPSHIKQNIIEKVNCQFYLSQDETYPSKELMLTGSCV
SLPDPQQILKFECYVRETTTKEIEIENRTGSEWQLIPIFTGEYFKGNDALIVPPLSKSQY
EITYTPLFMTKNKNYHEGSLFFCLPQGLGLLYVLNGVALPPNAEDVIVREVPSKTKFIEL
LKISNWLQQPQKLLVDIECTSREKERDERSWDCSGLKHFDLQPLAEKEYKLNFFSYKPGT
LKFKVTFVNNETYEYKWYDVTFNIVECGPLEILTMKCGVRQTCHEEIKLENPLLKTITYK
LSSTSPYISFEQNNYQVNPGEKASVYAKFSFTPVHPSDEIEQLHATCPELGLFPRQLHLI
SFEPQPEPTRLFQTYLGSFQIQKIKIKNFAKSNAILNCKTDSEEFIVNKTEQIGAEQEME
ISIKYEPSDMTTTIATVYVESEVAGNFIFPVSGICTKPIPKGPYLIKPGHEININFKNVL
NKSKDFYMFVDNPAFYLKKSQENILPKAVSFPDGEGEEYDIIIGLEKLKPLEKLTKNKEG
TIDPRFSFMGTLVVECYNPYIKWQFYLKGILD
Download sequence
Identical sequences E0VPS2
vb|PHUM363890-PA|EEB15378.1|conserved 121224.XP_002428116 XP_002428116.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]