SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM364100-PA|EEB15389.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM364100-PA|EEB15389.1|Sorting
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily PX domain 7.72e-22
Family PX domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM364100-PA|EEB15389.1|Sorting
Sequence length 164
Comment nexin-24, putative|DS235371.1:263622:264382:1|gene:PHUM364100
Sequence
MNEIKIENYRIVENGSKKPFCLYTIEIYVNGTRYVVEKRYSQFHALHEELRKLHPTPNFP
PKKVRSLQQRVLEKRKQALEKYLLTMLKFQQSRSHVLSFLGINKPENNHSSSDLEKIDEN
NMKHQPIFQFKKDIIPQGVRTSNIPDIVVDGIFLGLYKTTVNNL
Download sequence
Identical sequences E0VPT3
121224.XP_002428127 vb|PHUM364100-PA|EEB15389.1|Sorting XP_002428127.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]