SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM364110-PA|EEB15390.1|Neurofibromin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM364110-PA|EEB15390.1|Neurofibromin
Domain Number 1 Region: 1169-1490
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-87
Family p120GAP domain-like 0.00000000176
Further Details:      
 
Domain Number 2 Region: 228-415,997-1339
Classification Level Classification E-value
Superfamily ARM repeat 0.000000567
Family HEAT repeat 0.085
Further Details:      
 
Domain Number 3 Region: 1801-2252,2326-2407
Classification Level Classification E-value
Superfamily ARM repeat 0.00000419
Family PBS lyase HEAT-like repeat 0.088
Further Details:      
 
Domain Number 4 Region: 1531-1670
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000576
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM364110-PA|EEB15390.1|Neurofibromin
Sequence length 2686
Comment putative|DS235371.1:264804:277378:1|gene:PHUM364110
Sequence
MATQKPAEWVSSLITRFEEQLPCRTGPQTTYSKFNEEQNKKCLITISKYRFCLVIAGLTK
ILQRVIDMMMNTSNGVIKPMGPDMEKNCYESLVIVLETLKKCLTCESKDNTNFDENLNVK
LLLPHICQVIDSISHDNAYCVQLKNLTSKVLFALSINFFNAVFNRITGRLQELTTTTEEN
PDCTDLELIQYINVDVSKLTRLLAEMNQKFKLMKKSSHLILIVSLEKAIWNWMETYPHEF
GELQKKPNEELSKFCEGLFDILDSLSDNKKGRAVMWSLQIMLLILSPKVLEEIVNADSGA
PCSPRHSKKKQFIDAVKRAISPHGASKQLSEAAAVACVKLCKASTYINILDSNNVVFALV
QTVINDLKALLFNTVKPFTRGQNFVAQDIELMIDCFVSCFRINPHNNEALKLCLASTSPP
TYQFVLVSSLYRIVTQPRLSWWPQIDVMYSKSSELRSMFTDTLNKVTQGYISHLSIKMIP
SLSLTLKGKDSMSKYKERGDENSGYKNLLMLMVRLIHADPMLMLNNQGKTGHEIQSSTLE
LINGLVSLVHQPSMSDVAQEAMEALLILHHPDKIESWNPEAPINTFWDVSSQVLFSISQK
LIQHQIMNYTDILKWLREIMVCRNAFLLRHKDYANMGSKIPICKQAHIKLEVVFFMYLWS
IDMEAVLVAMSCFSLLCEEADIRCNSDEFTVTYLLPNYHVYQELAQASTVLTTGRAALQK
RIVALLRKIEHCVNGVHPAWEETFRNWDLSTKMLTSYPKAKLEDGQTEALHRSVGKRRSS
HQNSEHDLEEQINEWANMTGFLCALGGVCLQRKSPTKPGTSFGATTQHIEFRKCSSVLAG
SSQDVQYCPVTQFVGQLLKLLVCNNDKFGPQIQKHVKELVGHDMSPALYPILFDQIKVIV
EKFFDSQGQVIVSEYNTLFIEHIIFIMKNVLDTKLEQQPSEQLGITCIEGIMLGVVRYVR
HLDMTVHSLHNKTKLCQLVEVMMKRRDELAFRQEMKFRNKMVEYLTDWIMGSSHQMVPPG
NADVIPITRDLDQACMEAVASLLRGLPLQPEESDRGDLMEAKSQLFLKYFTLFMNLLNDC
SDPQEVEKDVGRQRANVTKLAALRNATIQAMSNLLSANIDSGLMHSIGLGYNRDLQTRAA
FMEVLTKILQQGTEFDTLAETVFADRFEQLVQLVTMISDKGELPIAMALASVVTSSQMDE
LARVFVTLFDAKHLLSPLLWNMFYREVEASDCMQTLFRGNSLGSKIMAFCFKIYGASYLQ
SLLEPLITTLIEDPEKNFEVDPSRLPNEDNIEQHRKNVINLTEKFFASICNSVDKFPSQL
RSMCHCLYQVLTKRFPQCPQNNIGAVGTVIFLRFINPAIVSPQEQGIFTKTIPPNAKRGL
MLMSKILQNIANHVEFSKEQHMIPFNDFLRAHFEVGRKFFVQIASDSESADQGAHSMSFI
SDANVLALHRLLWNHQEKIGDYLSSSRDHKDVGRRPFDKMATLLAYLGPPEHKPVDSHLL
FSSYARWSSIDMSSTNFEEIMVKHNMHEKEEFKSIKSLNIFYQAGTSKDGHPVFYYIARR
YKIGETNGDLLIYHVILTLKPFCHSPFDLVVDFTHTCSDNRFRTEFLQKWFHVLPELAYQ
NIHIAYIYNCNSWVREYTKFHERILAPLKGSRKLVFVEAPARLCEFIDVDLQKLPGATLS
LDEDLKVFNNALKLSHKDTKVAIKVGPTAIQITSAEKTKVLSHTVLLNDVYYASEIEEVC
LVDDNQFTLTIANESSLLSFIHTDCDALVQSIYHIRSRWELSQPDSVTVHQKIRPKDVPG
TLLNMALLNLGSSDPNLRTAAYNQLCALTATFDLKIEGKLLETSGLCIPSNNTLFIKSVS
ETLANNEPRLTLEFLVECIEGFRVSTIELKHLCLEYMTPWLPNLARFKRQSKVAHILEQL
ILLTIEEGEMYPSIQAKIWGTIGQVPDLIDMVLDSFIHRSVSSGLGSPMVEIMADTAVAL
ASANVQLVAKKVIGRLCRVFERTCKSPTPLVENHMLWDDIAILARYLLMLSFNNCLDVVK
HLPFLFHSVTFLVCSGSLSMRASTHGLVINIIHSLCTVTKPTFSEETQRVLRLSLDEFSL
PKFYLLFGISKVKSAAVTAFRSSYRHPHDRWFQNERSFSGVPQDREHLSLTSLEVITDAL
LEIIEACMKDIPDCDWLQTWTTLSKKFAFSYNPALQPRALIVFGCISKSVTDQDMKQLLR
ILVKALENFTDIALLEGLVMCLTRLQPLLRPESPIHRALFWVAVSVLQLDEFSLYASGLA
LLEQNLHTLISQGSFEDKSLEYVMMTTREPLEWHFKQLDHAVGLSFKANFHFALVGHLLK
GYRHPTPTTVSRTSRVLLQLLGIIAKTHKRDKFEVTPESVAYLAALVSVSEEVRSRCHVK
HSFSRILPELFESPFSKSDSHQQVYVFPTTPTNRRQKSWDLLDQGTFSQGPRHQKQVTMI
STRPLCRTQRSSSVPTQKSIVESASSSKVRINRSARVSVSNENNVLLDPEVLTDFSTQAL
VLTVLATLVKYTVDENETRVLYQYLAEASVVFPKVFPVIHSLIAAKITHVLTNCHDQGIL
NSVQAIIQNMVANEDNNQQLHYLQSCGFGGLWRFAGPFVKSNCPVDGAELFVNCLEAMVE
TCLPLEEGEQNIVQYPSMLSVSSNMNLSSSLSSLTLGSPTDKGENP
Download sequence
Identical sequences E0VPT4
121224.XP_002428128 vb|PHUM364110-PA|EEB15390.1|Neurofibromin XP_002428128.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]