SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM366140-PA|EEB15414.1|ras from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM366140-PA|EEB15414.1|ras
Domain Number 1 Region: 576-1051
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-126
Family Ras GEF 0.0000000000316
Further Details:      
 
Domain Number 2 Region: 14-185
Classification Level Classification E-value
Superfamily Histone-fold 4.89e-52
Family TBP-associated factors, TAFs 0.00000293
Further Details:      
 
Domain Number 3 Region: 420-582
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-32
Family Pleckstrin-homology domain (PH domain) 0.0000162
Further Details:      
 
Domain Number 4 Region: 211-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-32
Family DBL homology domain (DH-domain) 0.0000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM366140-PA|EEB15414.1|ras
Sequence length 1507
Comment GTP exchange factor, son of sevenless, putative|DS235379.1:90813:100869:1|gene:PHUM366140
Sequence
MFSSPSSAIESQNYDFEKAENAAKWKGVFVNSLRKVLEQVHSSLTARDDALEYVESLILR
LLGMLCARPPPHTTQDVEERVRRTFPTPIDRWALTDAKEAIEKGKKKSPLVLPVDRVHHL
LQKEVLQYKLDSQVSFYIVAVLEYISADILKLAGNYVKNIRHVEITCQDIRVAMCADKVL
MDMFHQDEGGSSSSTATIEESEGIQPRTSLTYEEVVKDLIHDEKQYLRDLHMIIKVFREE
IAKLTNNPKDLEDMFSNIMDIYELTITLLGSLEDMVEISEEKQLPAVGSCFEELAEAAEF
DVYGKYARDMMSSKSREALHRLLSRPEVSETLHTAGQGFCEAVKYYLPKLLLGPVWHCFL
YFDYMKVLNKLTPMVEDKESLEQVEGLLRPLQMELTSLIGNVARRDTNVRMHSRVRRQIA
IEKTNELQRSIDGWEGKDIGQCCNEFIREDVLGKLSSGKRLTERRAFLFDGLMVLCKPNS
KRTSVSVTTQQTTAEFRLKERFFIRKVYITDKEDTEDLKNAFEISPRVQPSVILVAKSPE
DKNIWMADLIMLNTKSMLDRLLDSILLDEEKKHPLKLPPPHLYKFAEADSKDNIVLDETE
GSGVPLIKGATLYKLIERLTYHIYADPMFVRTFLTTYRSFCSPQELLDLLVERFNIPEPQ
LFYDDNKETSESDKTIKNSQREDWKRFRKEYCQPVQFRVLNVLRHWVDHHFYDFERDATL
LEKLHHFLDTVNGKSMRKWVDSVLKIVQRKCDSNEIQREITFAFDRSPPPIEWHIRCPEE
EWSILTLHPIEIARQLTLLEFELYRAVKPSELVGSVWTKKDKEKTSPNLLKMIKHTTNFT
RWLEKNIIDAENLEERIAIVSRIIEVMMVLQELNNFNGVLAVVSAMGSAGVFRLKFTFQA
LSARLDKALEEARELNAGHFKKYQQKLRSINPPCVPFFGMYLTNILFIEEGNPDYLPNSP
KLINFSKRRKVAEITGEIQQYQNQPYCFSVELKIRHFLENLCPFENQTDAEIGNYLFNKS
LEIEPRMCKQPPRFPRKWPELNLKSPGTKPKNLPGRSHPPMPLPSIDRHRSPSTMRLQED
QEPETPKTPHTPPHRPTPDLIDNTVFMPVLIGGRSGNQSPGGQVLVSSATPSPGTSPSPA
HPPALPPPPPPPAKSIELVRLPSSKIVRSAVAPPLPPRRKKENSTGESIPDVPPRDQSPP
PLPPRSNPSHLQRRNSALDVGQNEGQTTVPRRHMSVNGPFLSTMPRSGHKALPVNHQIST
MPAPTFHVPNHSQDTQSHGQGVPPFYGHLSFGSHNLQATQTAILGTHNLSQSCRNSGNFN
FNTNKPVTIGTGMTGMTTTTTPPITTAPHPLRHHPHVRNFENVLENLELNNASSPTRKTS
HNFNFKSNSSDIDKQQQKTILTAYGKNENSPKLLPENLGIPYPGEELSNRLTAVSPQKST
KEIKSSRLSGNQEDIHLNCILSTPELPPKIHLGKKSPVYAKGSGETLFHFDSQKIHRMNS
SSQDGHS
Download sequence
Identical sequences E0VPV8
vb|PHUM366140-PA|EEB15414.1|ras 121224.XP_002428152 XP_002428152.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]