SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM370270-PA|EEB15471.1|Chromo from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM370270-PA|EEB15471.1|Chromo
Domain Number 1 Region: 652-932
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.86e-65
Family Tandem AAA-ATPase domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 380-650
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.12e-58
Family Tandem AAA-ATPase domain 0.0000583
Further Details:      
 
Domain Number 3 Region: 248-340
Classification Level Classification E-value
Superfamily Chromo domain-like 7.92e-18
Family Chromo domain 0.0001
Further Details:      
 
Weak hits

Sequence:  vb|PHUM370270-PA|EEB15471.1|Chromo
Domain Number - Region: 1225-1257
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00156
Family DNA-binding domain of telomeric protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM370270-PA|EEB15471.1|Chromo
Sequence length 1795
Comment domain protein, putative|DS235389.1:33093:43168:1|gene:PHUM370270
Sequence
MPQCGSDDSGSESDNKKSSGSDNESSSGSSKSKSDSDSDSSGSSITSNKSNSGSGTRSGS
ESDTKSEKSPFKTNVHLSAEKNGKKEDLKQCWEENPDVYGIRRSGRSKKEPERLEVRSGS
SEKGRKNSRRNSKSSNTWNSSVSDSDTDKDIKPRPPRSRPPGRKPAKPISRGRAKTQEKS
RKRRYSDSSDDSSDSDAAIRRTHTRRAGTGISYKEESEDEETGSDEVTEVNWDESAQTQT
AGETDTADTIEKVLAQRRGKKGAVGGPTTFYAVDENGDPNEGCDPNDREGTEIQYYIKWK
GWSHIHNTWESEQSLKDNKVKGLKKLENYMNREDDLAAWRKHASPEDIEYYEYQLELQSD
LLKSYTNVERVIEASVEDGNIINKKWPKKVQEYKEREESKRTPNKSCRALKVRPKFFQIK
NQPSFVGGDSALQLRDYQLDGLNWLVHSWCKENSAILADEMGLGKTIQTICFLYYLFRTH
QVYGPFLLVVPLSTMTSWQREFSLWAPEMNFVIYLGDVNSRNIIRDYEWWHTGTKRLKIN
AVLTTYEIVLKDKAFLGCISWAALLVDEAHRLKNDDSLLYKALTEFDTNHRLLITGTPLQ
NSLKELWALLHFIMPDKFAKWEDFEREHDHTAQKGYAKLHAQLEPFILRRVKKDVEKSLP
SKVEQILRVEMSSLQKQYYKWILTKNYSALRKGVKGSTTTFNNIVIELKKCCNHAFLTKP
SETENKSNEADSLQMLLRGSGKLVLLDKLLVRLKETNHRVLIFSQMVRMLDILAEYLQLR
RFQFQRLDGSIKGEIRKQALDHFNAENSMDFCFLLSTRAGGLGINLATADTVIIFDSDWN
PQNDLQAQARAHRIGQKNQVNIYRLVTKNSVEEEIIERAKKKMVLDHLVIQRMDTTGRTV
LDKKGSSVTPFNKGDLTAILKFGAEELFKDEEDGDEEPACDIDEILKRAETAEEAPATVG
DELLSAFKVASFAAFDEEKDLPAEEPEPEEETKDWDDIIPENYRKKVEEEEKAKEMEDLY
LPPRSRKTLQQINQSDSDNAEDKKAKKKKTEESEGEGSDEESDEERPKRRGRPKKCPFEC
EKPFSDAEVRRFIKSYKKFSTPLKRLEAVACDAELQEKPLSDLRKLGEYIERKCNELMIE
TQNFQKENSEINQNNEDSNLSVPTKKHRLRGPSFKIGRVSLNAKTLLATLKELEPLDEAL
PSDVEERKRWILDFRVKSANFDCDWDIKEDSCLLKGIYQYGLGSWEAIKMDPSLGISDKI
LLPDEKKPQAKHLLSRSEYLLKVLKKCLDQKKGVAKPKRQKKKLKETSKEIIDNHDVSSA
EENTIPSTLGTVKKIVKTKSEGEEEKEDKKKEKKVKKEKKDSSESKERKEKEGKAKRKKV
QGPMHFTANNKPRAVEVLGDLDPACKEKMRPVKKALKSLDNQDQSLGQQEQVQHTRMCLL
QIGDQINKCLSEYKDPDKVKEWRSNLWYFVSKFTEYDAKKLYKLYKHEVKKELEKKLGVK
EGEKDKEKIKEKKKEKLGKMLDVEGRGEKDRISNKRRIDDDRESSLSPAKKPYHEGKSRG
REDWMERDRSRSRDLDYKIKDDRRSHKESHHGAPLTPQRPGGSQNSSRHDYSPGDSRTTL
SPHGRNHRERDRDRDRDRDRDRDRERDRDRDRDRDRDRDRDRDRDRERDRDRDRDRDKDR
ERDRDRYNDHKRDRYDGYSRIPNSLYRDSRDSRERINHRRPYHQGPPPAYPNHYGVPPVP
YGMSPVGLYPPGEVPPPGIFSPARYAAPVGPSYGEWRGKEYRRGEYDGRRPPSNS
Download sequence
Identical sequences E0VQ15
vb|PHUM370270-PA|EEB15471.1|Chromo 121224.XP_002428209 XP_002428209.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]