SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM370830-PA|EEB15487.1|homer from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM370830-PA|EEB15487.1|homer
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 5.93e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM370830-PA|EEB15487.1|homer
Sequence length 397
Comment putative|DS235389.1:130764:132976:-1|gene:PHUM370830
Sequence
MGEQPIFSCKAHVFHIDPKTKRSWIPASNTAVSVSFFYDSTRSLYRIISVEGAKAVINST
ITPNMTFTKTSQKFGQWSDVRANTVYGLGFSSESELNKFIEKFKEVKEATKLEASIKATT
NGTNFAATPVTSANASPITGRAISGNRVPPETSVTDDNSIIDPPNTTLTNPTASAKNDQS
LSDEDKNNHGRSQSLSGLQPGESPKHQAKTEKPSQINIAPAAGESQLKYENDRLKFALAQ
SSANAKKWEVELATLKSNNARLTSALQESTANVEEWKRQLHAYKEENLRLKTCYLGLEAA
KEAAIELRKELTSLRQRVEQLELELKAKDEEIKRLSGKGDENSELQSAVTLAQAQLETAL
AAQESQRRVLDTLNAQLAARVAELAGIHREVATALQT
Download sequence
Identical sequences E0VQ31
XP_002428225.1.24195 121224.XP_002428225 vb|PHUM370830-PA|EEB15487.1|homer

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]