SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM372060-PA|EEB15510.1|p53 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM372060-PA|EEB15510.1|p53
Domain Number - Region: 10-101
Classification Level Classification E-value
Superfamily Prefoldin 0.000157
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM372060-PA|EEB15510.1|p53
Sequence length 130
Comment and DNA damage-regulated protein, putative|DS235389.1:375878:376357:1|gene:PHUM372060
Sequence
MDNPDKSLQYLKELESLGEEILVDRQEIIALDKRRNETREGLRELKNSKVTKTWFALGPL
LLKFPTNKVENLLKKDQVQVDAEINKLRSNLKVKVNLLRDMEHQPPVPGLMLKPMSKQEM
NAMGHVLGRC
Download sequence
Identical sequences E0VQ54
121224.XP_002428248 XP_002428248.1.24195 vb|PHUM372060-PA|EEB15510.1|p53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]