SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM377200-PA|EEB15615.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM377200-PA|EEB15615.1|conserved
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Histone-fold 0.000202
Family Nucleosome core histones 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM377200-PA|EEB15615.1|conserved
Sequence length 193
Comment hypothetical protein|DS235429.1:18:1757:1|gene:PHUM377200
Sequence
MLTSTVLEHAIANNGDLWGLLQPYAHLNAGRVASGALAMPRWDSMSSVSTDSTHTSSKNS
NKSLQQSLVTTCVGSTDQLRQLVNKITALQLHRQVISWSSTAINTLFYFMRCSQLEHGDH
QIQELVYERTYVVLPPLVEWVRVSSAHAEHRHSAVIDQDDVMQAARLLLPGVDCPVRQLG
QEEGGYESDNARK
Download sequence
Identical sequences E0VQF9
XP_002428353.1.24195 vb|PHUM377200-PA|EEB15615.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]