SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM378010-PA|EEB15637.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM378010-PA|EEB15637.1|conserved
Domain Number - Region: 119-185
Classification Level Classification E-value
Superfamily PH domain-like 0.00228
Family Third domain of FERM 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM378010-PA|EEB15637.1|conserved
Sequence length 672
Comment hypothetical protein|DS235430.1:93544:97309:-1|gene:PHUM378010
Sequence
MIPLLENEDLACFYVTKHSPWKGKYKRVFSVGSFGVTTYNPSSLEVTNKWLYSELVDIQP
ASSANRTEFILTFKKDKKIDSMRFSTECRSSLLTSVLACKYMFSDKPKDILKCQSYKHHW
SDTKLPVVLEVTASSLNQLDPATNVVLASYSYIDIKGFSEVKDYPGGFVIICEEFSRMHL
FSCDNLIELKSKILESASNIGVTIRVIKEPVTIQEFNNQRLGNYSGDEHITSISEFSVHK
ISHRHQDAQRRILCLTESCILERDPQTYSVCTLRPLSDVFALIRNKDNPQLFSIEYVNGD
SRNYTTSDRDSLLATLLDAVRGSGNHDVHVKMQSTSRGKRWGPLIQPLEQEVESLHLKFF
QQRPGNRSLNEIIDRFNANVPYSGLIHSVTQEGIFAENKEKLINNAIQALSNEDSEATNC
SNKELEAQFHALRRLFASKIGFTAFTVMQGLKENIGKKVISALRRNDDNVTHAAIDMICC
LMHPMHYDYEIRQEQINKASILSNKVFLSKLLDMWITHINRGTAALVVSSLLDFLTFALC
IPYSETTDGKDFDNLLRMVAERGRPIFKLFQHTSLAVVKGAGLVMRALIEEGESSIALKM
QNLALSEGALPKHLLTSLFTQGSDSRLLAHRKLSRHLVGLWVNDHSISMALLKPSRPIIL
FKLNRKSTRICS
Download sequence
Identical sequences E0VQI1
XP_002428375.1.24195 121224.XP_002428375 vb|PHUM378010-PA|EEB15637.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]