SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM378320-PA|EEB15648.1|guanine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM378320-PA|EEB15648.1|guanine
Domain Number 1 Region: 13-134
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000244
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM378320-PA|EEB15648.1|guanine
Sequence length 235
Comment nucleotide releasing protein X, putative|DS235430.1:175769:177158:-1|gene:PHUM378320
Sequence
MKFNIKELADLSFGKATIEGRLHHKKINSSHSNSGENLTVMLVFKEKWFKLRANILFYFN
LSETGQINNNKPVGAYILENTIVQFEMNSEAPFSFSLYFNDEVEKKHLFSGRSQDNIDKW
IEALKEASYEYWRSQLLLLQKKLSLITGQDPLLMYPRNKGCENVFKSSSSKKCDPDQKSI
IENSKSQFYTISDNKCKVNDAETFDSSKLCEMSPVRPARGVKLKTEVKCAKLVDL
Download sequence
Identical sequences E0VQJ2
XP_002428386.1.24195 121224.XP_002428386 vb|PHUM378320-PA|EEB15648.1|guanine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]