SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM378710-PA|EEB15657.1|kif21 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM378710-PA|EEB15657.1|kif21
Domain Number 1 Region: 18-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-107
Family Motor proteins 0.000000734
Further Details:      
 
Domain Number 2 Region: 1202-1280,1312-1516
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-41
Family WD40-repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  vb|PHUM378710-PA|EEB15657.1|kif21
Domain Number - Region: 903-1005
Classification Level Classification E-value
Superfamily Prefoldin 0.00123
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM378710-PA|EEB15657.1|kif21
Sequence length 1536
Comment putative|DS235430.1:227473:238496:1|gene:PHUM378710
Sequence
MCRICTSVTPGEPQITLSSEKSFTYDYVFDTDCDQEEVYNTCVRKLVDGALEGYNATVLA
YGQASFYYFSTGSGKTYTMGTGFEVEVQENQVGILPRAIHHVFGGIKERIQIACQNGEPP
PEFKVNVQFMELYNDDIIDLLDPTQGYISGVRIKIHEDCNGSIYVKGMTQQPVTSVGEAL
NLLRQGALSRTTGATQMNSQSSRSHAIFTLLIKQQKLVRIEDKNDVENNGKNEFATLSAK
FHFVDLAGSERLKRTLATGERAREGISINGGLLALGNVISALGDKTKKALHVPYRDSKLT
RLLQDSLGGNSQTVMIACISPSDSDFMETLNTLNYANRARNIKNKVVINQDKSSKTIAIL
RQQIQELQIELLEYKQGKRLVSAEGVEVVNDMCHENILLQTEANNLRVRLKAMQETIDTL
VKKNTMLLAEKAANSWIQCSTDGNVDVTEIVTGYLKEIQDLQAKLLESEALCQQLRKTTA
RQQSHFLSPTITLSSEILETDDHILIKPRSACELGRTEKSDNIISRRHHTFHEIPINKKN
SLREKNITHNNNNNFCKNNPNVNEAKMDLSKNLEILAKREKKEKNENDEGGLKAEGESDY
SDDDNEDSSVESSDSEDNESKYGLELAELTNEISIKQRLIEELERSQQKLHSMKQHYEEK
LLQLQERIRATQDERDKVLASFAGQYNQPSEKIKKVKDEYERKVNEMQKEVKRLESAQKQ
HAKLLKEQNHQSGQLKSLRAEVEDMKRTKVNLMKKMKEEVQKHKEIEMQKTKEIAMLRKE
SRKRENEIRSLQAENRVKEAVLKRKNEEVSALRSRARGIMSTKAAGRVLKMNNKTFSSKE
AKNKWTVIEKNINKIKLNKKAIAMSEKEMERLIAERESLGKELEQLIKKKNSLAFCRNLN
PNEVQVLDEQIESAQANMNYLQESISECQHNIMEIEDAKSENEFLTHQLVNTIEESRYLI
EKLYSMIVAQTVTNVRSELNLETLNAKIQQLTTDNDTQNQLLQHLISSHHLGIDIDSLKP
LANASQSNSENSTPASSRSSSPTFPSNAQSRSFNGGKSSNSAFSFLKHRRYTALPKELLY
PIENINKVEDETLRDAQNSQSSLKLIAPKPPESVNVNKKNYSETMSPRLPKRTVNLSNTK
LDMESTESPPGSPTAYRRFTSRGENVFSRLTGGTQDVEPSIGRGVISEYSGKTNNKAPFG
CVYVASGHSHAVLSVCVTDSLLFTSSKDRSVKVWDLHNGVEVQTMTGHPNNVEVVRYCEI
NRLLFSASSAYVKIWDLRESPSRCIKTLCSSGLTINGSVSLPSSSRAVTIPQGEQQLNDV
ALNKNGMILYTASGDRVRVWDLRRFSSTGKLAGGHQAAVMCLAVSKLSETEDVVVTGSKD
HYIKVFEVNGSSGGVFPPKMNLNPPHYDGIQSLALQDEILFSGSRDMCIKKWNLTRPKLT
QSINNAHSNWICGLVFMPGGQQLISGCRSGILKIWSVETCCLLGELRAHNSPINDVAVNS
SHVFTASNSGEVKVWRPHQSLSPMSMSTGKMFQLSM
Download sequence
Identical sequences E0VQK1
vb|PHUM378710-PA|EEB15657.1|kif21 XP_002428395.1.24195 121224.XP_002428395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]