SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM380350-PA|EEB15690.1|FERM from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM380350-PA|EEB15690.1|FERM
Domain Number 1 Region: 201-329
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-30
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 97-203
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-30
Family Second domain of FERM 0.0000953
Further Details:      
 
Domain Number 3 Region: 11-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-25
Family First domain of FERM 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM380350-PA|EEB15690.1|FERM
Sequence length 586
Comment domain-containing protein, putative|DS235430.1:413453:418548:-1|gene:PHUM380350
Sequence
MVKFYYKTVNNSNHKCTIRLLDDTEILECEFQSDHKGLNLLNYVCQQLNIIEKDYFGLRF
VDIAKQRHWLDLKKPILKQVREMNPVLFSFRVKFYPPNPANLSEETTRYFLFLQLKRDLL
HGRLYCSQNEAALLAAYIVQAELGDYDPEICIGNYVSNIKLLLKQTLPIEKQILEIHQTQ
LKGQSSSAVELLFLKKACQLETYGVDPHVVKDHKGNTLYVGINHLGVLTFQGSKKTRQFN
WSEIQKINYEGKMFIIHLVFYEKKHTVGFRCSTTSGCRYLWRCAVEKMLFFTLKKAADAP
VMTGGGFFSWGTKFKYFGRTEKEILQDTLFRKIKEPDVSLNGNLMRKSCSVPATPCTPAG
SDLSEMRCRSLPKADHYMFYSKLHPDYPPIFGDCPKNSLPCLQIVSTSQDHDLGKSRVQD
FRDLNECDDYYFRDSFDRSSCDSQSHTNKTTTITSSQKCSRNHSPLHSGSGTTHGTGSKI
LSPKRDVTHNPLLQLSDNHQDIQNSINTKNDITKFNLFQVFIPSFLFVVISLITATIIIM
ESDSDLVKNVNNLPEMISLRKHYYEPMKNFFANRFLKFMFKKEVKH
Download sequence
Identical sequences E0VQN4
XP_002428428.1.24195 vb|PHUM380350-PA|EEB15690.1|FERM 121224.XP_002428428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]