SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM386890-PA|EEB15745.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM386890-PA|EEB15745.1|Sorting
Domain Number 1 Region: 116-246
Classification Level Classification E-value
Superfamily PX domain 4.45e-31
Family PX domain 0.00054
Further Details:      
 
Weak hits

Sequence:  vb|PHUM386890-PA|EEB15745.1|Sorting
Domain Number - Region: 307-515
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM386890-PA|EEB15745.1|Sorting
Sequence length 520
Comment nexin-2, putative|DS235442.1:1551:3754:-1|gene:PHUM386890
Sequence
MADNDPPPLFDNVVISSSAGIDEDSDNLFVSAYENESDLNTNNQTLLNENDNEIKNKNEN
EKEIENDNDNDNDDNDSLSETNHSLFESTEFNIEKCEDEHEGNKNNQLLEEIDTENNDQF
LEITVTDPQKVKDGIGSYMVYKVNTKTNIPKFRKNQFAVNRRFSDFLGLHEKLVEKYLRA
GRIIPPAPGKNVFGATKIKIYNQGELGEFSDFIEKRRAALERFMVRIAAHPFLSTDPDFI
EFLEAEGGLPKATNTSALSSAGVLRLFNKVGETVNKITFKMEEKDSVSFLHGFYLTYHLF
SEIKSSQIDNLDIQLRKLHASVESLVMHRRELAELTSSFAKSAALLSSCEQHDALSRALS
QLAYVEDKVEVLYNNQANSDFSILCELLNDYVALIGAIKDVFHERVKVYQIWQHAQLMLT
KKRELKSKFELQERREKSAQVANEIIEWNAKVERGQKEFDNISHMIKKEMERFEINRVKE
FKIIIIQYLETIMNRQQELIKHWEGFLPEAKIITKTDYEK
Download sequence
Identical sequences E0VQT9
vb|PHUM386890-PA|EEB15745.1|Sorting 121224.XP_002428483 XP_002428483.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]