SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM387540-PA|EEB15759.1|shc from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM387540-PA|EEB15759.1|shc
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000564
Further Details:      
 
Domain Number 2 Region: 303-410
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-27
Family SH2 domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM387540-PA|EEB15759.1|shc
Sequence length 419
Comment transforming protein, putative|DS235442.1:53707:56008:1|gene:PHUM387540
Sequence
MSRPLPDLFGSEKNIFINKPPQGWLHSDQVILKKGITYAVRYIGCLEVNTSMKSLDFATR
SQVAKECINKVCEVAGLKTVDKKRKIEKAVQRCIGDKPIMDHAGANVNLTVCSSSLILTA
HDSGKVIAGHEMPRISFASGGDTDTLDFVGYVAKDLEDWRACYVLECGGGLAQDVIATIA
QAFDLRLKQFLSTTGPQNEVTTRADDGEYYNDLPGKIPPDVGPPPVPPLPAPHHHHTVIN
VPASESSGFSHQNLKDNGTNLIDLHSDAPIATELEYVNVIPVSSHSNQTTQSNDVFDLRH
LGSTLSNKQSQVIQRNQLEQEIWFHGFINRQEAESLLKKDGEFLVRESQGSPGQYVLTGM
QGGLKKHLLLIDPEGVVRTKDKMFESVNHLINYHVENQLPIISAESALVLRHPVRKASH
Download sequence
Identical sequences E0VQV3
vb|PHUM387540-PA|EEB15759.1|shc XP_002428497.1.24195 121224.XP_002428497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]