SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM394550-PA|EEB15887.1|E3 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM394550-PA|EEB15887.1|E3
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.14e-56
Family N-terminal domain of cbl (N-cbl) 0.00000271
Further Details:      
 
Domain Number 2 Region: 251-337
Classification Level Classification E-value
Superfamily SH2 domain 4.41e-47
Family SH2 domain 0.00000572
Further Details:      
 
Domain Number 3 Region: 343-423
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-40
Family RING finger domain, C3HC4 0.000016
Further Details:      
 
Domain Number 4 Region: 166-250
Classification Level Classification E-value
Superfamily EF-hand 3.13e-37
Family EF-hand modules in multidomain proteins 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM394550-PA|EEB15887.1|E3
Sequence length 455
Comment ubiquitin-protein ligase CBL, putative|DS235459.1:119804:137734:1|gene:PHUM394550
Sequence
MMAANSRTRPAQHKNITSIFSKLHGAFAEAMAPPKVATDKRTLDKTWKLMDKVVKLCQHQ
KMNLKNSPPFILDILPDTYQRLRLIYTKYEDKMTVLHSNEHFNVFIVNLMRKCKQAIKLF
KEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGLFAGDQFRITKSDAAEFWKSN
FGNSTLVPWKVFRQYLNEVHPISSGLQAMALKSTIDLSCNDYISNFEFDVFTRLFQPWTT
LLRNWQILAVTHPGYVAFLTYDEVKARLQKYINKPGSYVFRLSCTRLGQWAIGYVTQDGD
ILQTIPQNKSLCQALLDGYREGFYLFPDGRNVNPDLSWAVQPTPEDHIKVTQEQYELYCE
MGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVEDSEGQGCPFCRAEIKGTEQIVV
DPFDPKRQHRAGSGAANALVDLDDDEEVSDTSECH
Download sequence
Identical sequences E0VR81
XP_002428625.1.24195 121224.XP_002428625 vb|PHUM394550-PA|EEB15887.1|E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]