SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM395920-PA|EEB15914.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM395920-PA|EEB15914.1|conserved
Domain Number 1 Region: 14-120
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000028
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM395920-PA|EEB15914.1|conserved
Sequence length 332
Comment hypothetical protein|DS235459.1:323314:324927:1|gene:PHUM395920
Sequence
MLLIYVFQPNTLPGHAIQRGILWQQRDKLFARWKERYFILTRDYLHCFRKATDNGFDRIS
DMGPFIFKIKLVDVEKVTWINKKTYSAISLDFKRDGRILLRSQQGLEDWFDALEECTLAS
KERRQALKCSRDSYHQGENEQNMNSYNSNVEDLLAVRNKIALLQRDYISDSVPDVSKFGS
PSLKSLFISESRSEDNDDDKSSNNVPYSAINRRLSHINALNTSSINTKATPIPCRLNSDV
FYLPGLSNARQRSSIAGETVNPPKESYLNDLGRSRLGTNASDYKSKNFLNPFRIPNMLQS
TKGTANRYSLIDDTESIKVIYSSYEKSPFTSS
Download sequence
Identical sequences E0VRA8
121224.XP_002428652 vb|PHUM395920-PA|EEB15914.1|conserved XP_002428652.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]