SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM400130-PA|EEB16037.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM400130-PA|EEB16037.1|conserved
Domain Number 1 Region: 6-105,154-180
Classification Level Classification E-value
Superfamily Chromo domain-like 7.33e-33
Family Chromo barrel domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM400130-PA|EEB16037.1|conserved
Sequence length 327
Comment hypothetical protein|DS235478.1:598293:600175:1|gene:PHUM400130
Sequence
MAPTGTKNNKFSEGEKILCFHGPLIYEAKCLKFRVNEDDNNLNEYWVHYAGWNKSWDEWV
PESRILKYNDANVARQKDLQKSHKSRLQKKSKGSTPKAVKSAAKESKSSDAKSDVSLHDS
DSSPLPLQESSLDVPKRKKRPKLDSTFETETQYMQKVEIKVKIPDELKPWLVDDWDLITR
QKKLVNLPAVRSVDQILDDYLKFKANSKNNSKYMESACQQVVTGLKEYFNTMIGSQLLFK
FERPQYSDLLREHPDKPMSQIYGAHHFLRIFVKIGTVLAYTELNERSTTLLLAMLQDVLK
YLYTNAGSLFSIQNYGIAPPEYHRKTV
Download sequence
Identical sequences E0VRN1
121224.XP_002428775 XP_002428775.1.24195 vb|PHUM400130-PA|EEB16037.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]