SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM404590-PA|EEB16096.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM404590-PA|EEB16096.1|hypothetical
Domain Number 1 Region: 12-152
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-36
Family Phosphotyrosine-binding domain (PTB) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM404590-PA|EEB16096.1|hypothetical
Sequence length 1669
Comment protein Phum_PHUM404590|DS235562.1:32188:39024:1|gene:PHUM404590
Sequence
MQTLRRRTSPCKYKNDPSRFLGEGITFKAKLIGILEVSEARGDKMCQDALNDLKTAIRAA
GEHKQRITISISIDGLKLRDEKTGDCLYHHPVHKISFIAQDMSDSRAFGYIFGSPDTGHR
FFGIKTDKTASQVVISMRDLFQVVFELKKKEIEMAKQHTEQHQTKYGSTGFIDSLHLSKD
ENEFDKNKGKYSQLLKTRCLSSKSNEPNSSSDFKVPDSEAIADLLDLEQGINQIDKISSS
DPFGSLCRDNPYDPFDDSFSNKLNQPSNEKVLSDIITKPHHLDNSSSDLDKNSSFFESVP
STSKANFFCQFSPDSSEPGKFNKTEHKWFEQENDNVFDDLKINGSNNEQITSSSAVLNAP
VPPESETNDSIKSPIKTDLFTELDPLGTGRVKPYVDKKDFFQDLKNPPKKILKEIISDGT
LADASSSYFPTQFPNDKILKSGKIEGISESIKDSSLTGKTSKTDPFENADPFKETDPFQE
ESFLSSTGFSPIFGTKPSLDEIFDEKASWKFEKFKPFKEENVESNSYSTSFSLFSSSTLK
VSLPPERTDTKTHSLSSPNTKINMAVNSLDDLNQRKQTQQINLDKNLTETSENESQVLEE
PFVKSEIKTSGPKPDVLKSPFKNKFSSLSSPTETKTEKSVTKLYSSVEVLEATTPDPPPR
AKTAVFSIKPPPLPPKKLNQTNVKPPARPPLGEERILHYDHVQQDKVDRINFNEKLKNVK
LDGKSSEDNGSSSQHNDSVNKVSSEPFFPVLLPPPNRKTSIDSNKTSSKKPADVKTEIAP
GTTTGSVLNIKLMQLDSAGLENLAATLGVPSKNIYSMTLQDLTKMLTEKYKSLGGGDQEK
KTVDDTFEADFDSNFSKPETESNTTYDKYAVFKELIQSECNEASPFQNQNESEEVNSENF
KNSENEIRQPEDPTEDKYAALRQLSLNVQETEKIEDGGKIAEVEEIESDPKKSISTGNPP
ETSTISKSTESQTANTNAEYGDWASNTSWLKLSETDKPKEIQTLSSESQFFPLEDDFSDE
KKPSSFRDNWATFDKPEFNETSKKKSLENLYENENSPFSSDGKEEEKEIPFHWHQNVGRR
KKCKEMCWKDDDESWDDYSPKESICSDESSREDGSPDVDPDNQFENALWTMRDKIPKMKN
WKTKGKQQQWIHNDKWQQDETEDEFDDFWRRQKDRSASYETTKRNYWRGKSYDDQKKRYD
WCNTWGEHCEDSGGGGGGSRRSHYYGNRRKRSESDHEYRKRYDSDASDKECIWSFQKNYS
EPQNRTGKQKSHLYGSSRPFKDCSDYHYGSYGKHRKETSSQKRPNSASECKKNYEKMFSP
YYGNHSFNETGDKTYPGKKNITKEEFFNRNPKDVIINKCRSDFEFDITDRRINNNSSQKF
KQNKMRGYLGSPPPGKKDNNYTETGIVEKPETSSTRFRFDSESDNFDKDKISIDTSSKYS
FDKSNRWSLTNGKTEEEINTFNPKNTTIDPSFSTAIKSPKKKSNDNNFDNNKSINCKSTV
KNQLSKTSRQDPSSSSSTLLRKSDSINIFSRDNDPFEEPEQLPAKVYVGKDGNVGASFGG
YSASAGLGGILTGDVAKGGLHAEAGTPQGHFASAGLGGSVSESGGAHGHTYSKSGKIEPV
VVSGVQSSESSGTSNVQTSNNVRIGGGGGVVEGPQKSTFFDDIFNVSQN
Download sequence
Identical sequences E0VRU0
121224.XP_002428834 XP_002428834.1.24195 vb|PHUM404590-PA|EEB16096.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]