SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM404830-PA|EEB16100.1|goodpasture from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM404830-PA|EEB16100.1|goodpasture
Domain Number 1 Region: 353-568
Classification Level Classification E-value
Superfamily Bet v1-like 9.78e-32
Family STAR domain 0.0074
Further Details:      
 
Domain Number 2 Region: 21-124
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-22
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM404830-PA|EEB16100.1|goodpasture
Sequence length 580
Comment antigen-binding protein, putative|DS235562.1:54948:57166:-1|gene:PHUM404830
Sequence
MSDNIQCLTCSEEDEDSDCGNTSSEIQGTLNKWTNYIHGWQPRFIILKNGTLSYYKSEED
SGFGCRGSISIFKALIKPHEFDECRFDINLNDCTWYLRADTPEDRKHWIDVLENYKAESV
FGSEMSLKRHGSSVSLQSTTLSSASASSSKKCRGLKEKLAELDTFQNILCSQMDVLQKYF
DKCAEMSSDSLINGHKDNVINVNGSKFVYEINPDHGVHAIDFKGEAITFKATTSAVLTTL
QHCLDLFTQKEEVWKKKLDKEIEKRKRLEELYNAVKDEMSFQKSKVVIQGGPDLEEGPHS
KLKDEEFYDALETSLDKIQEDEEFRERLKSKQILVHQLGSSPKHSSLWPEIEKISAEQIK
YALQEVGSGSNWHLFAEEGEMKLYKREEMVNGMVMDPLKACHVVQGVTGHEMCHYFFSPD
VRMEWETTLDSSTVIEALDKNTLIFYQVHKRIWPASQRDAVFWSHKKSIPNQTDAEGQDI
WTVTNHSVDLQEFPANTGKTVRIYLTVCLLCQTFVDPPKTGLNISRENLRCKITYCSVIN
PGGWAPAAALRQVYKREYPKFVKRFTAYVVDRCKSKPIMF
Download sequence
Identical sequences E0VRU4
XP_002428838.1.24195 121224.XP_002428838 vb|PHUM404830-PA|EEB16100.1|goodpasture

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]