SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM404960-PA|EEB16103.1|4.1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM404960-PA|EEB16103.1|4.1
Domain Number 1 Region: 188-328
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-41
Family Third domain of FERM 0.00035
Further Details:      
 
Domain Number 2 Region: 86-190
Classification Level Classification E-value
Superfamily Second domain of FERM 6.93e-34
Family Second domain of FERM 0.000039
Further Details:      
 
Domain Number 3 Region: 5-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-21
Family First domain of FERM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM404960-PA|EEB16103.1|4.1
Sequence length 664
Comment G protein, putative|DS235562.1:68469:74626:1|gene:PHUM404960
Sequence
MLKVHRIILLDEQELIREIQDVTKGQEVLNSVFKHLNLLETAYFGLRYVDSSNQTHWLDG
TKGVVKQLKGSDPFSLYFGVKFYAADPCKLLEEITRYQFFLQVKQDILQGRLPVSFETAA
ELGAYAVQSEIGDYDPKRHSKGYVSEFRFTSNQTAELEARIEERHKDLAGLMPAAAEFSY
LEKVKWLEMYGVDLHPVLGEDNVEYFLGLTPSGIIVLRYKNKVGHYFWPRISKIYFKGKY
FMIKICGRNNEENTYGFETPSKSACKHLWKSCVEHHAFFRLLQVSPTATDIFSLGSKFRY
SGRTEKQAQADVQMQLRTPPHFLRTSSRRYQRRQFDNSEVPTIVQRENKNQNNLKNVSVP
QPINSVYRSMTNLPVGNYGNDPPESPHSTRSAPWSTSGRSRGLYNVSPKSIKNQRSCSSI
QNLQKTSIRSSSVDSQSSNDSRCCKRHKRHRSRRSSDNDSELSKCSSRSHRRHKSGNDSD
GGRNHKHKRKNRSSNRSSRYDLVDSEPQWLEVQKRQAEGNTGVQQATVINNISRTSGYLN
SGMETESEKSYRYKRKQHKKHRSRSRSPSDFIKGRLPDEVKKHLEFKLIDTEGMTETQLR
DIPYKVVETNSKGKTHRKQSSPSGKRKHYIKNYDRDLKPQTLTEDKTEISIQQNSILERS
YHIC
Download sequence
Identical sequences E0VRU7
121224.XP_002428841 vb|PHUM404960-PA|EEB16103.1|4.1 XP_002428841.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]