SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM405120-PA|EEB16109.1|titin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM405120-PA|EEB16109.1|titin
Domain Number 1 Region: 79-263
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-35
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 917-1014
Classification Level Classification E-value
Superfamily Immunoglobulin 4.27e-24
Family I set domains 0.0089
Further Details:      
 
Domain Number 3 Region: 273-386
Classification Level Classification E-value
Superfamily PH domain-like 7.04e-22
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 4 Region: 822-919
Classification Level Classification E-value
Superfamily Immunoglobulin 1.75e-20
Family I set domains 0.0052
Further Details:      
 
Domain Number 5 Region: 631-730
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-20
Family I set domains 0.0034
Further Details:      
 
Domain Number 6 Region: 1111-1208
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-19
Family I set domains 0.0091
Further Details:      
 
Domain Number 7 Region: 1007-1096
Classification Level Classification E-value
Superfamily Immunoglobulin 8.07e-17
Family I set domains 0.0081
Further Details:      
 
Domain Number 8 Region: 1206-1300
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 1692-1793
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.0094
Further Details:      
 
Domain Number 10 Region: 524-616
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-16
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 745-810
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000404
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM405120-PA|EEB16109.1|titin
Sequence length 1836
Comment putative|DS235562.1:94983:106175:1|gene:PHUM405120
Sequence
MNLIIANAYINYLGNDEIFTTLDNSAAKHKISIRPKKKYAETRHRNLSSIINSISSSGNY
EEENSYQSSIHGNKENEKSDVTCKREAVVKELLETEDEFCKDLSYVVENYLKPSENYNVP
TIVRDNIDVIFSNFKLILNFHNTVLKEGIYYYSTEPEKLGKVFLRLERDFDKHISYCRDV
SLAEDFLANNTQAMEFFENLSQQLKDGKNILEYLQLPVQRINDYQVLLKDLIKYSEKLGK
CTQDLKKAHELMLAIPQRANDNKFLNNIEGFHGNIHKFGRLLRHDWFTVESGNNSNSKER
YLFLFKSHIIICKVKKISEDRSIFVLKELIPLKEVKIKNLADDNNTFEIYDKNIIDKPEI
LFKIYSRKDNIKDIWINDIEKNVENVILLKEIDDVNNKNVNDCVEIQVYNQTNVKDGNDK
DLIENKIDINLEKENDDDDRNTMNRRYSVRKSHKTYEESYSVTGQRETYVHRSTTAASSQ
FSSTSGFDSEVSYSRKSSFITGSERRSSSTFNSNLAISGSGKKPIFLKKITGLNLEPGET
AIFECQLESDVKVTWLKDNKELEDKLADRVVRSSSDDGTHRLELQHVAESDSGVYTAYAQ
NDENYSTCTAQLVVEKGASKHKEISKDSSAPFFTVRLKDTELMLNTNFTFMVKVKGSPNP
RVKFYKDDMIIRSGNDHVEINDEKSDIGYYELIISDVQKHHGGVYSCKATNEHGEAHCEG
TVTINDEKVIFKGLENSDKIDLGRKPSFTWFKDGKHFDPDERFKVLLGNEEDSLALVFQH
VKPGDAGLYTCVASTTAGKISCSAELSVQGVLNPLSREPEKPSFSEEIKSEIETEVGKSA
KLEAKVLGFPRPDVKWYHEDTEIKPEGRYKFLYDDKETITLVIKNVNPKDGGFYKIVAKN
ELGEECTELSLIVKGAPVITKKLENVKVKENSEIKLTTVIEGSPTPDVKWFKDDKEITES
SRIKITTDSTNNTYTLKINKATAEDEGSYSITASNEINHCSDSCTVTVSSSPKILKSMEK
NVEISEGEKIVFNVETSGEVDDSNVKWMKNGKPLVSDDSKIKITAEDNKHTLIIFDAKID
DSATYSVEVSNENGVVTEEGKATVTRQTCAPVLKKGLQDILAKEGDSNVEFSVEVNAYPK
PKIKWYLDGMEITEKRKEYTKMEDDNNYKLILKKVTTELKGNYKCRIENDYGSAETTAKL
TVESRPIFVKILEPKITVDEGSELTLQVECAGCPEPEISWFKNGEELSTDAHIKIMKDSH
RSESYSMSLTLIKRSDSGEYEARATNCMGSAVTKTYVQVISNIIETSKEKSPEEEEVKKL
EEDKKPEIKLEETIIESVENKTENLTKGKIEDVDDVKQCEVQVEDYKAEPEKVDTLKLPL
NKLLMGRRESVKFEEIIENSQIEETQNSSLEVVGVVEECVDSDNEISYRKLRVNRGVSIN
SVSEDEKSLSRNNSNGELNEKLEDEFELENGKKESATWMENKTDLKKIEEEIKPSSKKAE
IADMEINENELSESNNVKPDESSKSESNDTNSDEIEENDKLPDSQKTVDYFYSPNNKSDK
ESYDEKDDEEIPEKHKKPFETSKFENDKQSENELQDNEHDDAISEDIEKQPEMPITNKTE
KESNDISRDSYIKKAEYETQKISTNEIDRESTPDDDPVVSDLLKRIKKQRSVLEEILTKE
ADTSKEGEEIKPSFKKPLKDVKVTKEEKEVSFTCTVTGNPEPEITWSLNGKQIQVDGKKF
ISEKVKSTDDENKEEYTCTLKIKKPSEAEAGLYLVKADNKYGYGESSASLTIEIQEEEEE
EHKPEIKRLKDVVAILNEDAVFEAEIISDSPVEVSW
Download sequence
Identical sequences E0VRV3
121224.XP_002428847 XP_002428847.1.24195 vb|PHUM405120-PA|EEB16109.1|titin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]