SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM407270-PA|EEB16142.1|Guanine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM407270-PA|EEB16142.1|Guanine
Domain Number 1 Region: 568-762
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-46
Family DBL homology domain (DH-domain) 0.00000257
Further Details:      
 
Domain Number 2 Region: 765-884
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-31
Family Pleckstrin-homology domain (PH domain) 0.0000415
Further Details:      
 
Domain Number 3 Region: 965-1034
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000368
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 70-167
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000157
Family CRAL/TRIO domain 0.0093
Further Details:      
 
Domain Number 5 Region: 263-399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000122
Family Spectrin repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  vb|PHUM407270-PA|EEB16142.1|Guanine
Domain Number - Region: 177-263
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.00222
Family MW0975(SA0943)-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM407270-PA|EEB16142.1|Guanine
Sequence length 1047
Comment nucleotide exchange factor DBS, putative|DS235634.1:179225:185799:1|gene:PHUM407270
Sequence
MRLLFPRNRQANKHTNTFSRRHECRGKTEHGCPIITFPDIGNFSTLGDLEYQRLMVYLTS
VPSMQEADIGFVLVIDRRNDRWNSVKPTLLKLSGYFPGLVHAVYVLRPSGIIKKTISDVL
NKLFKEDFKFKVIVCNSLEELHSYIDKSQLTSDLGGSIQYNHSEWIRQREDLEIFSEEMK
QVSNELDNFTKKMKETEIPKQAEAVQELLTLHQKEYGDLKEKLRNAVKHGETLLEIFRKS
QNSTTVNDVNAQDGNQNDKFGNVSAVERLIVQLEETEKTFCSFQTDHFTKLKQWLDRRIF
EQDVTELEIKFDECLKIVNDMVEVGESVSRVDELIKETNAFHKICKINIDRGEEVISNGQ
RLIKSKLYSSEETLQPDCDKIKKLCTLLTERLDYRLDTLKKHRELQEQIDKANSWCARGI
ELLSNQQIEKAAGDAELIQKSITEINLFLNTSENLRLNSPKRLFKDNIITPETKALVTQV
VQRIADVTSMCDKRLASLHLLTANRQRPVQTVTPEPGVPLQPSHGAPILNKPKILRKANT
IAKLEDPWNQSKINQCIDKDIPTQDPQILKSKRQHILAELLETEQIYVNELQSIIKGYKR
EMESPEMKPLIPPELIGKGDVLFGNLEEIYAFHNDIFLKDLQNCISTTELVALCFTHRKN
EFYKLYSCYCQNSPKSEQLRELIGERNFFFGACQIKLGHKLPLAAYLLKPIQRITKYQLL
LKDLLRSTEIPKCRNQLQEALKCMLVVLKCVNDSMHQIAITGFRGDLSDQGELLMQGSFS
IWTESKKIRELRLTPMQRHIFLYRKAILFCKKENKENNKATYHFKRFLQMSQIGLTESVK
GDPRKFEIWLQGRQQVHTIQASTIEQKMAWVQQIKEVLLEQLAELRGANMRQYSQTKTPI
LHRALRQTTSWESQSSMDSSAGNNNRAFSCDETNSHIQTLIESEEESSDLSNSDDENQSF
GDQILGGRYVVLADYRSQGHNEISLQEGSLVEVLKVGCGGWWYIKLLDYYFQGQPIEGWA
PSAYLEVCNKKNKTQKNNVSNDDVIVT
Download sequence
Identical sequences E0VRY6
XP_002428880.1.24195 121224.XP_002428880 vb|PHUM407270-PA|EEB16142.1|Guanine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]