SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM415050-PA|EEB16275.1|histone-lysine from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM415050-PA|EEB16275.1|histone-lysine
Domain Number 1 Region: 662-850,990-1067
Classification Level Classification E-value
Superfamily SET domain 5.23e-73
Family Histone lysine methyltransferases 0.00091
Further Details:      
 
Domain Number 2 Region: 593-659
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000589
Family Methyl-CpG-binding domain, MBD 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM415050-PA|EEB16275.1|histone-lysine
Domain Number - Region: 316-372
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000669
Family Tudor domain 0.012
Further Details:      
 
Domain Number - Region: 97-159
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM415050-PA|EEB16275.1|histone-lysine
Sequence length 1077
Comment N-methyltransferase, setb1, putative|DS235748.1:180176:185651:1|gene:PHUM415050
Sequence
MESTVIQERKESSINLGEAPVFVLTYFNVPRKKNVLQKVCDECFETALKHQEKMCHLLKN
NFSLFEAEFPKQKDDVVVMDSVEEIAEEKILPDSVVSVVEEHLEELLKDALNKYDIDFQI
ESGQKILTKKIEELEASRKILNDELLSIENQVKESRSAIYKAFSPQIKELQPLNLNDSIN
QSYGKKLRKSMADALNKILPYNSAPNVPISVNAEPENFESHEVVTLREVEVPKVKLPPIG
ALNYPSVNVGTLVYVIKDTVFGVWVKAKVVEVLKRENDGVSNFRVQFESSHQGIGQKIVS
GKEIAYRKPSSVRYPVGTRIVALFHNSKAPSKSAFYAGIIAEPPKILNMFRYLVFFDDGY
AQYVTHHKIMLVCECSKFVYEDFHSDSRDFIKSYLDQYPERPMVKLQKGQLVKTEWNGKW
WMARVLVVDGSLAKMHFEADNRTEWIYRGSTRLGPLFQELVAAEARKEQGALSRHRGLGI
ASLKKVKSNFTKNMPYVEYSVDQDDKLPQSSSLSKNVARKSSVSKLNHQNDNACEKPVDR
FRFNEKKEINTKGYIRTMALPRRICGQIFVPHQCGPSCVDWTNFSPAVCKNISPLAIPLL
YGYERQITRCRSRKSVSYRGPCGRRMRNIIEMHRYLRITKSMMGLDYFDFDPRVHVLDEF
HLEPSMYCTHDISYGHENVPVSCVNEINHSWPSFMDYSTSRIPQEGVNICYDEEFLVCCS
CVDDCLDKEKCECWQLTLEGAKYAFKDQIDSKIGYQHKRLLEPLTTGIYECNQRCKCGPT
CLNRVAQHPLQLNLQVFKTLKKGWGLRTLNDIPQGGFICIYAGRLHTEQSANDDGRMYGD
EYLAELDYIEVVERYKEGYESEVIEPDFENDDEDEKQNCTMDADRSYDEQDESLMNNDDI
DYVPEGLSRIPDTENIVNTRGRNKKITSEEKSESEGEKEKEDADNDRDSENVEDDDDEIS
KKPSKFTAAVPVTEDQPKYRSVREMFGDGADDCYIMDAKSSGNIGRYLNHSCQPNVFVQN
VFVDTHDVRFPWVAFFALSYIKAGTELTWDYNYDVGSVPGKVLYCYCNSAECRGRLL
Download sequence
Identical sequences E0VSB9
XP_002429013.1.24195 vb|PHUM415050-PA|EEB16275.1|histone-lysine 121224.XP_002429013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]