SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM417170-PA|EEB16289.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM417170-PA|EEB16289.1|conserved
Domain Number 1 Region: 1080-1191
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-29
Family SH2 domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM417170-PA|EEB16289.1|conserved
Sequence length 1195
Comment hypothetical protein|DS235750.1:21866:27749:-1|gene:PHUM417170
Sequence
MNLFFYVKSKNASYRISREFGTNALRSSTGYDGQNDEPIQHVERRPSPYYYSDILNQDDL
EPSAFKSYRKPETAKNSTVEPFYSQSSKQLAKERKQLESYHPFSAKENFEPKQGGLDFYD
FASGRVRKKHKVVEVNEKKKLSRRTDEKKEENKFDEEKILIERVKDERSGNDDEYNSKRQ
GYVKSISLDVPSSIKKKTVQQKKECRKSASLDIPFVSNVSIDEVGENSNKFRPIVPVRET
EEGGIEGGDEEEEDEIRSRKKSFKKLPQYNHCYRDCLTGAPKKTFPCGDKFSPADVLQHV
IHGGIDNKSLLAACLAEWDAHARLMRPLTARALTQCACAIGAQKQCASSDEEEEEDYHYT
KSPLSINFPPRKNTSLDSIRKRDFFKEPIPDGKNLGDEFVKGQKVKSEIDDGNISPLNPR
EIFRNWGIIVNEKGGFESWNDGYDDNSDSAEAYKIAREILEETENWDLEKKNILLKPECR
STESLYDFENMSRRGLLYETAFDCKVSRSDDDLEELDRVTNHPILHSRIGRSKSAVTAPL
IESYTRPPRPGSSFSKNPLKPFTKEKKSRISSSDAENASEDISNISDRVKNITLVQTPTP
PSTAPLPSKFCGHEDFTMNSIKSAPELSSKNNRIKDSKLPVKSLRGRNSRPSSLLTSFND
PLINSDEKRDDASEESLCQNYQNSNDNNINNNNNKSQKLAQKTELILEFKGRPEGESTNK
KPRAARPRSLIGEIRPTVVLGQRKNGRLKFSSTESVATSSSGGSLESIKSSTSEGNRSTT
SSESHRSSSLSSHSSDSMSNVVAITTANLQYHLKQTNPHDTNKMQNALSPISDKSSVEPS
ETSDNNKNNNSQKPSPEESHDNGTNESQHHSHHPHHQHHNHPPMSSSSSPLPPPPPKLDF
KVKRKTLQNKNLINLGLQMSSSSNEAAQGSDSGISVESRTLKSSGIFSNQTETDFSDLPF
DMPKLRRRRLVEQENVLNRRLLEVDACTSSSATSVDLRDLPFDMPKLRRRLRPGGNTGES
QASSSQSVAEQTGNVLFRPSMTLSLDLESNSIQNQTRGLSLDLERGRGCGTMTLNAFSGV
DLIDPSLPLEKQTWYHGSITRVEAEDLLRSLKEGSYLVRNSESAKQDYSLSLKSAKGFMH
MRIQIDNNSGQFILGQFSKPFNSIPDMIRHYSVNKLPIRGAEHMCLLKPVAAQLL
Download sequence
Identical sequences E0VSD3
vb|PHUM417170-PA|EEB16289.1|conserved XP_002429027.1.24195 121224.XP_002429027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]