SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM418650-PA|EEB16327.1|myosin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM418650-PA|EEB16327.1|myosin
Domain Number 1 Region: 9-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-231
Family Motor proteins 0.000000000838
Further Details:      
 
Domain Number 2 Region: 1879-1990
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-20
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 3 Region: 1767-1888
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.33e-19
Family Ras-binding domain, RBD 0.057
Further Details:      
 
Domain Number 4 Region: 1193-1267,1296-1310
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.59e-17
Family Ubiquitin-related 0.081
Further Details:      
 
Domain Number 5 Region: 1304-1425
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-17
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 6 Region: 1994-2081
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000846
Family Third domain of FERM 0.041
Further Details:      
 
Domain Number 7 Region: 1426-1518
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000347
Family Third domain of FERM 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM418650-PA|EEB16327.1|myosin
Sequence length 2123
Comment putative|DS235751.1:32333:41192:1|gene:PHUM418650
Sequence
MKIILLLLQEYVFRYHGKKIGQLEPHVYALAEAAHTSLKTCERNQSCVISGESGAGKTET
TKFILQYLCSVTSNVSTWVEHQILEANTILEAFGNAKTVRNDNSSRFGKFMQVCFDNKWM
IKGCIIQDYLLEQSRITFQSRGERNYHVFYQLLEGAKNNPELTKQFHLKPPNFYKYLNQS
GCVQIEGVDDAKKLDVLRLAFNVVQVPAQMVDGIFAVISAILWLGNLEFEDVDGEKCKLA
EEDKTVLATVSDLLKLNEQDLARVVLLRQINVRGNITEIPLKLQEAKENRNAMAKALYSR
TFAWLVNHINTCTNPGQDSSRFLGVLDIFGFENFLMNSFEQLCINYTNEKLHKFFNHYVF
ALEQEIYRQEKIEFSHIQFTDNSSCLELIEKPPRCILKLLTEQCHMPKGSDSAYLTNLHS
EFESHCYYVKGDDRRKWETEFGIRHYAGTVTYTVQGFVDKNRDVQQDVFFDFMSRSTNEF
IQEITVYQDLLGSTVAKMGGTMARGTTKGKPTVSDTFRYQLQALVDVLQATNPWYVRCIK
PNMEKSPNSYNEKLVLDQLKYLGMLEIIRIRKEGFPVHMLFSDFVQRFKCLSKTRLSNDL
KEATSAIINTHNISKTEWQIGQTKVFLRFRAYDPLEDSRQKILNACAILIQRTWKGFVVR
KSFKRKRSAVLKLQHAYRGWKQRIQFIKMRRAAIVIQSHLRGVFAREVAAALREMRRVEE
EMRKREKLEEERKKREAEEEEERKKNYLEELERATQEQIEALNQIAEQINPKLMSTDHCG
DSVDLDNLFAFLSDMQPGSRHNIIEEISSHMEDLVEDLDVELESVIQQELEGLTNGISNV
DVRLRKNPSLPEPTMPPPPPPFTNGTGKPSAIVIPKTGEKSGNEPIYESVIPRDESNSSP
PPLPTPPQKIRPKSPSVDHVQRNSLERSTSPRPRPPGSPQCHSRPNSRSSSGVPQNWKTH
REEDLEKEQRRKFRVEKKLQELEEDDKERVANDVDDSYHDIVEFAQNFFNAHERSPEGTI
MATLTRKTRKSMEMMPKYEMVTYYKGNTIPNSHIHMYDPDNVTVACAIFRDLCKFLRGEL
KPETEVATIQTIVGHGIEREELRDEIFVQCIRQVTNCPQTEWMERIWLLLCLCIVSFQPS
KHLYKYFVCFLKKNLSLDGKLRQYVQWCLDNCNNNRVTNRTFPPSAVEISAMKRLGTIVC
RFFFLDGRTKAIDVHPTDTAADAVVKLSDKLGLRNIEGWAIYESRLDGEEHVKAHDYLYD
VIAAWEQKQNKAGNNNNNNTSFPSLSRRGNQTTLNPGENRFIFKKRLFRNSRTLSQDPVE
INMLYAQAVHSVVKADDFPVSEKVALQLAGLQAQVALGDPRPDNNKLTDYYAGVDTYLPY
RISKSRGEDVWISIISEAHSQYGTGRSELTAKALYLSCVMQYPLYGTTMYPVTYRGYWSY
GNNLILGVNCSGLMLIKPDDKFVLYEYRYQNIESIFLDPSDSFITINLMRQIPDNTHKCF
VFETPYKNEIGSLIVSYCPALANWIIENEAAVRKVKAITNEDRTRLYNNLVNARKNLVES
DLLRKSVEPGGGFIRSTLRRLSKSRIEKLRADYGGEGEGVKGYPYTFWAFSKQPLTQSFS
KIPESDEQIALQVFQLILNYAGLGQNGDIIRRAEDEHVNLLQTIMERCMRKDVLLNELYL
QLIKQTTDHPDPNSRVNLRHWALLSLACSVALPPHKQLRKYLIAHLKRCASDCITEEGKY
ARFAEKCLYRTQGTRRRQWPPSKEEIMCTINRRPIYARFHLMDGQYHAIEFLPSATAREV
MDVMKSKIGLKESAMGYAIYEVLGSSERSLVPDEKVADVMSKWERYRTATAAQANTPANG
TNTIQLRVSRKQQHFFLFKKHLFLDQYMNLEDPVEKELLYHQVLHGLRCDRFPISEQEAV
MLTALQAQLELGDCGDILLDYRGVASHCLAPRFVPNVPHECVAMHHQSLHGMTQPEAKKS
FLNLIQSWPLHRATIFDVMQSFTSNWPRVLWLAVDQTGLHLLEHRSRNALVTYDYESILS
YSPALNCLMIVTGSERKQSKVILTTSQAFQIANLIKEYCEVLQGGCENKDILRRRDGQQQ
HQYSSRPMSILHKPAPIIEQAAS
Download sequence
Identical sequences E0VSH1
121224.XP_002429065 XP_002429065.1.24195 vb|PHUM418650-PA|EEB16327.1|myosin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]