SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM424430-PA|EEB16491.1|moesin/ezrin/radixin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM424430-PA|EEB16491.1|moesin/ezrin/radixin
Domain Number 1 Region: 195-336
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-41
Family Third domain of FERM 0.000000737
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-37
Family Second domain of FERM 0.00000316
Further Details:      
 
Domain Number 3 Region: 483-565
Classification Level Classification E-value
Superfamily Moesin tail domain 1.18e-26
Family Moesin tail domain 0.0000929
Further Details:      
 
Domain Number 4 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-24
Family First domain of FERM 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM424430-PA|EEB16491.1|moesin/ezrin/radixin
Sequence length 565
Comment putative|DS235758.1:366576:378235:-1|gene:PHUM424430
Sequence
MNVRVTTMDAELEFAIQPATTGKQLFDQVVKTIGLREVWFFGLQYTDSKGSLTWIKLYKK
VMNHEVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNSILSDEIYCPPETSVL
LASYAVQARYGDYNKAYHGSGFLSNDRLLPQRVMDQHKMSKEEWESSITTWWNEHKGMLR
EDSMMEYLKIAQDLEMYGVNYFEIRNKKGTELWLGVDALGLNIYEKDDKLTPKIGFPWSE
IRNISFNDKKFMIKPIDKKAPDFVFFAPRIKINKRILILCMGNHDLYMRRRKPDTIDVQQ
MKAQARDEKIAKLQQREKLQLEIQARERAEKKYLEVEERFKIVTEDLAKKKQDLHEAQES
ITRLVEQLKEVQVAKDELEARQNELQMMIIRLEESKNMEAAERQKLEDEISAKQEELLRV
KSEVDIKAEETKRLQMEVEEARQKEKEANMQFLAASTTPQHHHVAEHDDENDDLPNGDVT
KELETDSNIVDPVEERRTLAERNERLHDQLKALKQDLAQSLDETKETAMDKIHRENVRVG
RDKYKTLREIRKGNTKRRVDQFENM
Download sequence
Identical sequences E0VSY0
vb|PHUM424430-PA|EEB16491.1|moesin/ezrin/radixin XP_002429229.1.24195 121224.XP_002429229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]