SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM424760-PA|EEB16509.1|coiled-coil-helix-coiled-coil-helix from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM424760-PA|EEB16509.1|coiled-coil-helix-coiled-coil-helix
Domain Number - Region: 146-182
Classification Level Classification E-value
Superfamily Cysteine alpha-hairpin motif 0.0178
Family p8-MTCP1 0.049
Further Details:      
 
Domain Number - Region: 24-118
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM424760-PA|EEB16509.1|coiled-coil-helix-coiled-coil-helix
Sequence length 200
Comment domain-containing protein, putative|DS235758.1:496121:496903:-1|gene:PHUM424760
Sequence
MGTAQSTPTRKITIPNEESQFIKISESVAERLRKCTETSPQDMMKNQPKDECEPAENHFK
NVKNSEPNPEFSGDALINYYYGPSITSIRILQEKEKELKESEEYWTKRIANMEKHHARLN
QIMKNEYNKAIVEISCQSPRPAPDSPFPCFEQKNKLLECYKKNPKEILLCAGEVNEFADC
VHAKRIYIEKKGTECNSVVM
Download sequence
Identical sequences E0VT03
121224.XP_002429247 XP_002429247.1.24195 vb|PHUM424760-PA|EEB16509.1|coiled-coil-helix-coiled-coil-helix

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]