SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM424880-PA|EEB16512.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM424880-PA|EEB16512.1|conserved
Domain Number 1 Region: 712-895
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 495-590
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000258
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 3 Region: 923-1017
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000284
Family Ras-binding domain, RBD 0.026
Further Details:      
 
Weak hits

Sequence:  vb|PHUM424880-PA|EEB16512.1|conserved
Domain Number - Region: 601-701
Classification Level Classification E-value
Superfamily PH domain-like 0.00127
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number - Region: 1037-1103
Classification Level Classification E-value
Superfamily PH domain-like 0.0331
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM424880-PA|EEB16512.1|conserved
Sequence length 1151
Comment hypothetical protein|DS235759.1:9606:18621:1|gene:PHUM424880
Sequence
MISEGDGKPIKKPVPLPRKSLLKQNKNSLKETLLSKDEKNNGLFKEKEEKNFVRDDWKSA
SESFVFEKKRLMKSEVNKFEKSVRNIISRRKSGHTKSLNIAPKSELTRSDSLPDNSIFCN
ISFNSPLAEGSIIHSDKVDGCVDKNYYENKVTHPPNYPPPDPPDESIYDQMKIVDFPNLH
SDFSYISNNSSSSISTGSDCMTPCDFDSNREISKYDLSLVPGPKNVNNRYEIVGNSAIKN
CSDEENSSLNQSPTPSETEKCCSEVADCIKNNAKPFNSQIKYIIHLFDPLQDNKLNVSDN
TLDLLYSESTLKLKTSDSCFIDSKESEPANHTKDAEHIKMKTQNIIPPNLKEGHYGKIKK
PSSSSIELPSVQPNIEPPPIPPRNFPPRSLSESLENKKESSREVKSKSTVIKNEKEISNA
LEEKHKSSDVMQWSSLKRVAKKVADNIEHRTSYLSLSGKKINKNSDEEFPTKSLSKVKSF
SGIGNLCQLPQNFSKHSGIMYRPGGIERWGVLSQRKLTLFANKDSPDVKETVPMDNVLSI
QATLNKISNNETLGIYCFEISVASRNQLLLFGVPSISERHIWMRKLLESIGPGFSAKLSM
DYTKAGWCFAKESVACVWTKYCILLHHRTLYLSSELVPIIAADLRKARNITLQVEGFTCE
KVTEKGPLILVDLQDKTLYLQMDYVRETKAWELAITAAALKNGPSLCEQQLTKDDVPTIV
DKCLNFVHTQGVFSEGIYRRNGSNRAVSQLLASFRCNAWSVQLSRDEYTEFDVSSVLKRF
FRDLPEPLLVPEIQEDLGKILAFTNVKEKIEEYKNTLKKLPSINYLTARRLLCHLHFIDK
LKEKNLMGAENLAAIWGPTILQVQEQVSLGSDCFKMETLIVNNLICFYPEIFDVKEEEVE
KEMKILKMLESYHTNSNSLNKKPSGELKIWVYLYSHKNTDNCVNISINPQKTAEEVCKEL
SAKTNESLHSLCLEEVICSGHLSRPLNHSEKVLDTVLRWSYWEESDRKDNCLVLTKNDLF
QQVVKYSKFPVIVSEELKFADQKSKTFKTCLFEFSQAKLICYKDKMCSQKIGEWKIEDIV
WYFGHEPKRIPNAKWSITFIEKNSMAPRTKEKIYFGNTICGSSEEQKLKLITAMLTAQYS
KDILPIPNLME
Download sequence
Identical sequences E0VT06
XP_002429250.1.24195 vb|PHUM424880-PA|EEB16512.1|conserved 121224.XP_002429250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]