SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM425010-PA|EEB16515.1|presqualene from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM425010-PA|EEB16515.1|presqualene
Domain Number 1 Region: 43-186
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 5.76e-25
Family Type 2 phosphatidic acid phosphatase, PAP2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM425010-PA|EEB16515.1|presqualene
Sequence length 206
Comment diphosphate phosphatase, putative|DS235759.1:26983:27682:1|gene:PHUM425010
Sequence
MAKRKVPGLLRRILNQDEKLTEKFCLFMNKFLPFRQLRVHHKALEITCHGAAWLAGWLIF
IYLINSPKLYQMQVNFYIGLILDIIFVAILKAYTRRKRPSGNTPDMFLTIGVDKFSFPSG
HASRVTFIALFFMFLYPLPIFCFPPLMAWLVSLSISRILMKRHHILDVLGGILLGIVETF
ILSLLWLSKESSATILSFMNEENLED
Download sequence
Identical sequences E0VT09
121224.XP_002429253 XP_002429253.1.24195 vb|PHUM425010-PA|EEB16515.1|presqualene

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]