SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM430580-PA|EEB16634.1|myosin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM430580-PA|EEB16634.1|myosin
Domain Number 1 Region: 4-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.71e-260
Family Motor proteins 0.000000000285
Further Details:      
 
Domain Number 2 Region: 2840-2935
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000129
Family Third domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  vb|PHUM430580-PA|EEB16634.1|myosin
Domain Number - Region: 2725-2839
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000536
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number - Region: 2314-2344
Classification Level Classification E-value
Superfamily SH3-domain 0.029
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM430580-PA|EEB16634.1|myosin
Sequence length 2941
Comment XV, putative|DS235761.1:171184:202794:-1|gene:PHUM430580
Sequence
MSLVLVDLNEASLLWNLKIRYDKELIYTYVGSILVAVNPYKMFDIYGLDMVKKYENQILG
TLPPHLFAIGSSAYAALNKTGESQVVVISGESGAGKTESTKLVMQYLAAVNKSPSNLVTE
QILEASPLLESFGNAKTVRNDNSSRFGKYLEVHFNKGVIIGAKVTEYLLEKSRIVTQATE
ERNYHVFYEMLLGLPESQRQSYGLLTPEKYFYLNQGGNCEIDGKNDRDDFQSLLSAMQVL
GFTNEEQDTIFRILASVLHLGNVYFHRKQLRHGQEGVEIGSDAEIKWTAHLLKLNTEGIK
DALMTKTTEARGERVQTPLTIDQSLDARDAFAKALYHTLFSWLVARINQIVYKGTKRTAA
ISILDIFGFEDFQENSFEQLCINYANENLQFYFNKHIFKLEQMEYAKEKIQWQTINYVDN
VPIINLIAKKPVGILHLLDDESNFPKATDVSFLEKCHYNHALDELYSRPRMSSSEFGLKH
YAGQVWYNVDGFLDKNRDTLRSDVVELLISSKIKLISTMFENYRNVYESTKTINKANGRF
VTMKPRTPTIAARFHDSLQQLLTLMDQCNPWFVRCIKPNNDKAPMKFDMPIVIEQLRYTG
MLETIRIRKTGYPIRLKFSQFYDRYRYFLPDRGSTVAKGTPYRELCRFIFEIKECNSNDY
QLGTTRVFLRENLEREFEKERSEILHKAALTLQTNVRGYLARRKYHNIKKSTIKLQSAVR
GWRERKKYKIIRRGIIAAQAKFRGKRQRKRYLELSAELKRRAAAEKAARDRAKVKAQKEE
QERASRAVAGVNHLEIPAELAFIFSKLDDWEQTHTERNLVKVVGTVASSGPKKHHHLPQD
IDHHAFTKFTNIYFKSHVWGMKREPIKTPFLAKAKDMDYQDSLALFKLILRFMNDNNLNG
KKETVLGDYIVNKGLSNDKLRDEILCQLCNQTWNNTNDANNERGWLLMANCLSVFPPSHT
LQKYLLKYVSDHAYDGYKALCQRKLLQIQSLELPLARCYPPNVLEWRSNRKRVNMALPLY
FSDDESATVEVDSWSTGEDLAGFAIRNRGIQECNGWSVVLAGEDDELIRESMGCDYVMDL
ISEMEIAPAFPVSKNSLLMGHDRIAPKSPMNDDIEVPLIAPRRPINPPPQPPVRKQSREL
LEETVNTPRKPINRIRSQSKDHTVESGLSRKSALNDRYFEDGRSRSLDNLLDPEVAMPYK
LDNLGLSRSRLNDRYHSVDKIPSNNSIIEGRAVTNQEYMSKSEILLEENLESVSQRGESH
RAIELNGSTDGLNDNQSDVIAPLSNVNLDYDYQDIAARSEDDKGSYIRGHPRFIKSQYAG
KRAAPGSHSSRAYIEKSDYAAKSSALSDTSEAPSLASHVRRVRVPSQASDVDQFLDDLFM
PVLDGNLDELSDARSLAASIKGGGSKKIVENDDDDDRDDNEVASFTSSAQISVGQPYRSR
PNVENVDDYITNLFQPIFVNDSVNKLANASTLAQKIKGGGRGVQDKSGTQPGFTPITNMT
SPTNVIPGMMSPPPMMMPLFSPTAQSSASLSFMGPGGVTGAAQTMSTANFYPASPDAMMQ
SAMLHSIPIYNIQGLNHPNQQMDTNLLAYQQNLQRAFLQSAMAQNIQIQQQLFAQNQALQ
QLLQQQQPTGAPIKSQQQTPVSFGTENSDFWKRENKDEQNPSLSSSKISRGFNATPVQST
ITAQIHREQSPLQMNYGIPAPPPLPPPPDAVDPHNRPFIDPYGRAKTVRIGKWRWPPPQD
GSQEGSDSFLQFKLRQQRKTTPQKQSSQDSNEDRTEIIEWEEFEMSITDKTEQSSRKSSV
STRRESKEHKSSMKSFELGAQRPSPGSIGKLRISSEMRHKLEMVTSTHSVRSTAKPEKPS
LSQVSNMNVPRKLEDNRRLLLEQQLAGRWGSVDSVDQIARVVTKEERVDLQPTNIVRSQV
ERMEKTSPTGIPSNQNTQWRPNPPPAPVAPHHMDGQQKKPQPPSRSSSIYSSSINPTARP
RSPPPPIQPVKRNNFNGNSDLFGINTKESYGHQDYNGRTNGRRDDMFEDHKKENYNNLRN
REDLTNPDLTRSRESLFKRKVELDRQSNISEHIDRIEIEESSEFLKPMDIAPPTSIQRHY
EVAETKLFPPSTAAFFTYNRIPWKLLVRKEVFSPSEKLTNPLAVHLVFCQIVKDVLGSNC
IRITRDQRADMKKLLDGYGITINNVSSQNHKQTIKKNIVELAKEWETYFCRLYPVSGGQT
HRTVQYLGISHSGIRLIRKEKGVPQDHLQIIESVQFDDVIETSVPKNSAIEIILRTGGRL
VLYTQRAPQIRSMIQKYIVEVEKVRCFLYAYSVEFVRSVADHTSNRDPSVLNFRKGDIIK
ILSPEHYNQQYQENTRISDKGTENWTGRGPQQRILHSQSKINHKEHNNNNNSNEDEIVQT
SINDGKHSLLQFAMHYFRQSPEKFEMLKTADGSISGSLKVIEGKNKKSKEKGKTGKNTSE
WTWKEQVDLVKFTAKPIAQSLLQLDTSELSDLAVECFICLMRYMGDLPMPTDVSEVKCVY
TILMHCHKFEQLRDEIYCQLMKQTTNNKSIQQESCQRGWRLFSIVAAYFVSSDTLKPFLF
KYLETAAYDKRRAYHGTAMVCLQNLRKTFKYGGRKNVPSVEEITAISAGRNSKRQIYRLP
GGTEKVVNTKSTTVVQDVIEELCVMINVTNPQEMEEFSVYCIVEGDTFTMPLAREEYILD
VTTELQKNHQVFYLIFCRSVWYFPLRLDSQLYVEVVFNQIAPDYLEGLLLVIPGESLEQD
IIYDISKIAALLHKAADMTHIPTMKETKFLLPKPALSVRDVKPSQWVNMVQSNWQDCENM
STIQAKAQVLDILSKWPLFGSSFFAVKKAVESKDRTDHILALNRNGVHFIDLITHETLLH
YPFSEVISTRKVKSEDGTLFLDMKCGNLMQQRITRLQTDQAHEISRLIRQYITMQQRMGP
N
Download sequence
Identical sequences E0VTC8
vb|PHUM430580-PA|EEB16634.1|myosin 121224.XP_002429372 XP_002429372.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]