SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM438090-PA|EEB16802.1|Exosome from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM438090-PA|EEB16802.1|Exosome
Domain Number 1 Region: 63-148
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.19e-22
Family Cold shock DNA-binding domain-like 0.0000808
Further Details:      
 
Domain Number 2 Region: 151-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.2e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00038
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 2.72e-18
Family ECR1 N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM438090-PA|EEB16802.1|Exosome
Sequence length 236
Comment complex exonuclease RRP40, putative|DS235773.1:79675:80385:1|gene:PHUM438090
Sequence
MESLINSIVVPGDVILDLTAEVKSKIIVGPGLRVSSNKIIATKCGILHKKGSNVYWVDSR
QKRYVPAKGETIVGVITNKSGDIFKVEIGASEQAQLPYLAFEGATKKFRPNINVGDVVYA
RLLVANKDLEPELVCVDSHGKKGKLGVLPSDGFMFNCSLNLVRKILNPKCPLIDTFQRTL
QIPFEIAAGMNGNIWIKAKTVNETIAVANAILAAEYKSDSEIKELCENIGNALAGF
Download sequence
Identical sequences E0VTU6
XP_002429540.1.24195 vb|PHUM438090-PA|EEB16802.1|Exosome 121224.XP_002429540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]