SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM440090-PA|EEB16833.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM440090-PA|EEB16833.1|conserved
Domain Number 1 Region: 40-104
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000851
Family Chromo barrel domain 0.036
Further Details:      
 
Domain Number 2 Region: 110-162
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000417
Family Tudor domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM440090-PA|EEB16833.1|conserved
Sequence length 307
Comment hypothetical protein|DS235774.1:250754:252592:-1|gene:PHUM440090
Sequence
MTLQLALLHTFSFAVGINASSQTDSYDTNKSSTSEAYDMKDFCPGIRIEAKDFDGKWYPA
KVSDVDWTENEILVHFENWNTKFDEWIPMDSSRLRPLQKPVLQKKDNGKFSKGEEVMAMW
SPYQKYPATIQAVLSNDRYDVLFYDGFLKRLKGHKISKLEGETVKNEVRNFTDIGTKEER
RERKRKINVAELFHVNKRSKKKGLIHSKSQGLKTYPVSKSKNKGSVIRKLLTPEEGKDKV
TKTDSVESKQKEEKVPSSTTSSKALIDTIPAAFEVKYLNGQTEMWSKQLYQRSEGRTAGK
LDIVILK
Download sequence
Identical sequences E0VTX7
XP_002429571.1.24195 121224.XP_002429571 vb|PHUM440090-PA|EEB16833.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]