SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM441290-PA|EEB16866.1|insulin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM441290-PA|EEB16866.1|insulin
Domain Number 1 Region: 103-204
Classification Level Classification E-value
Superfamily PH domain-like 5.95e-24
Family Phosphotyrosine-binding domain (PTB) 0.00016
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-19
Family Phosphotyrosine-binding domain (PTB) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM441290-PA|EEB16866.1|insulin
Sequence length 288
Comment receptor substrate-1, putative|DS235777.1:236409:237433:1|gene:PHUM441290
Sequence
MKKKFFILRGESSDASARLEYYDSEKKWRNSQPPKRTISLKTCFNINRRKDTKHKYVIAL
YTKDDCFCIVLDSEEDLQEWLRVLLKLQTGEECVDGEQPKPNFEHVWKVTLQEKGLGDSK
NLVGPYHVCLTDQTLTLVKITEDDAKPETLEFPLIYIRSCGVTGSFFYIEVGRQTVTGAG
ALWMLTEDANIAKNMNEVIFSAFSVQQKNQKDSNPHRKRSSSATESSKPTSILQRRQTHG
PTKPIVSSGYSDKRTNKQTNKQTNYTFCYLFILFSYDDLPIYDSKRID
Download sequence
Identical sequences E0VU10
vb|PHUM441290-PA|EEB16866.1|insulin 121224.XP_002429604 XP_002429604.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]