SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM449080-PA|EEB16981.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM449080-PA|EEB16981.1|cAMP-dependent
Domain Number 1 Region: 40-356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-82
Family Protein kinases, catalytic subunit 0.0000000319
Further Details:      
 
Domain Number 2 Region: 311-331,403-519
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-37
Family Pleckstrin-homology domain (PH domain) 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM449080-PA|EEB16981.1|cAMP-dependent
Sequence length 534
Comment protein kinase catalytic subunit, putative|DS235785.1:39641:41796:-1|gene:PHUM449080
Sequence
MNGGGNGGNCIDSLSVASRLSTSSEEGSKPKENVVEKRDPNDYIFGKAIGEGSFSTVYLA
KDIHTNMMCAIKVCGKSHIIREKKVEHTKREKEILSLLSSKSRKTAPFFVRLYCTFQDKS
RLYFVLSYAKNGELFSHINKVGSFDIPCTKFYAAEILHALEHMHSLGIIHRDLKPENILL
DDKMHIQITDFGSAKILKKEESSDEDSPTKQRRNSFVGTAHYISPELLTDSSECSRSSDL
WAFGAIIYQMIAGLPPFRSNSEYLIFKKIKNLNYEFPDGFCPCAKDLVQKLLVVDPSKRL
GAHDGDTYSSIRSHQFFNGMEFESLYCQTPPQIYPYLPGTSDHGELRSQYRVPDHFEPGL
DDRQITRLLGLDLQGTSPPKTSSPEPPVEKARKKSGLGLEHLTPEEIKSRLAEQKVTSER
WHSLCDGNLILKQGLVDKRKGLFARRRMLMLTLGPHLYYADPVSMVLKGEIPWSPELRVE
PKNFKIFFVHTPTRTYYLEDPEGYALEWCKAIEEMRVHTYGCDKNPIRVGECRT
Download sequence
Identical sequences E0VUC5
121224.XP_002429719 vb|PHUM449080-PA|EEB16981.1|cAMP-dependent XP_002429719.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]