SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM450970-PA|EEB17047.1|Rho from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM450970-PA|EEB17047.1|Rho
Domain Number 1 Region: 88-267
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM450970-PA|EEB17047.1|Rho
Sequence length 830
Comment GTPase activating protein, putative|DS235786.1:216744:220146:-1|gene:PHUM450970
Sequence
MVNLLSNDVILLSEKLRNEDPEQFYTLVKMHLSFVLDLNTDECDNNTEKKSKAVKWNLPF
TKKQKVNDKNSLDGPPLTYDFITQMKPIIEFLRKEENICQEGIFRRSGRVTRQQELKLLL
HQGITLNFDENQFSVHECATVLKNVLSELPESVLTDAQYPAYCQIAELCNVKNHSYNERL
LRALQLLILLLPNENRIFFKEIIELLNLAVAHEHKNRMSAENLATLFTPHLLCPRKLSPE
ALHVNSQVMSGVVAFMIQMGSKIFDIPPTVATDVKAYWNKKEKRINSPLKQMNESICDGT
AANTVFTFVDREKTAEENRTNPTVTALAQLYAYIQALPESSKKRKLIKQFNKENGYGTPL
RNTVNKKRLKPLNLGDSIKSPDSGMCCKKFTKEEEEEEQLLINGSGALNNKSPLSTKIIH
AKNGDTRKTFLNGEQQIVKVSNIKNDFQLNKEMCHHQEGSSGHNREKDSRENSLENTPKY
NSKRSLSSLSKDDIILSKTSRLSEEKKFSEGSSSTGGSDGGNLSFVSNKNYVKFKCFSKN
KLNSLEMSTKEEEEKKEERDFDDEFSVRKLNNSNVVSGTNNNEGFLHFSINNNTNRLPIS
YCPKSTYLMTTSTPAPTSTCFFTPKVDKNNSMSPITKSARRMPKAMQETMMTPRSRKPVI
SLSGTDLCSLVNSDSGGMDLGESDETKSKILNNKMGKKLIMEEDSTNERDGDSLSSPFRN
YLYSRSVLTASPVDLSFSSRADDFLSLTDDDDDDDDDDNSSKENYYNRLPEIINRGGGGG
GGDLSESLLYCLDGNEPNDGHFDKNEKEYNCSCSSSYSDSLNSQVYETAL
Download sequence
Identical sequences E0VUJ1
vb|PHUM450970-PA|EEB17047.1|Rho XP_002429785.1.24195 121224.XP_002429785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]