SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM454520-PA|EEB17134.1|beta-1-syntrophin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM454520-PA|EEB17134.1|beta-1-syntrophin
Domain Number 1 Region: 138-247
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-21
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 56-155
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-20
Family PDZ domain 0.0017
Further Details:      
 
Weak hits

Sequence:  vb|PHUM454520-PA|EEB17134.1|beta-1-syntrophin
Domain Number - Region: 267-364
Classification Level Classification E-value
Superfamily PH domain-like 0.000195
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM454520-PA|EEB17134.1|beta-1-syntrophin
Sequence length 485
Comment putative|DS235793.1:33678:36166:-1|gene:PHUM454520
Sequence
MVNHKISSSPKIRIGRVSVSDGKCKPLSMRLCLTTELLKLQNEQKEQFECFVKTPPIDSR
ERTVKIKRRKDTGLGISIKGGSEHKLPILISKIYPKQAADETGELFVGDAIIKVNNEFLT
ICPHDEALEILQTAGDVVTLYVKHYKAATPFLQHASSKENYLNHVVEEQRIEEYAESAES
IFNMRYIDVVTVPLMMAYVTRYIFGTDKLRPNAFEVRGLSGTSTGIIHCSDSANLYRWLK
YITDNIVGLTHLQMKLYNRNFPCTERIEYMGWVNEAITDGSLTRQTYKPKFLTLKGMDIL
IFESPPLNVIDWLQCGIAFKVYQTMFRVLKESEHKDERQHCFIIQTCGQEVKYLSVETRQ
ELLRIETAWHAAVCSTISKIRHKTFTVKWAGRQCGLTLDWNYGFVLRDIELKALLWSYKF
SQLKGSSDDGNCRLKLHFQDSDTKIIDTKEIECASLQNILFCMHAFLTAKVVSVDPTFLS
CTYKI
Download sequence
Identical sequences E0VUS8
vb|PHUM454520-PA|EEB17134.1|beta-1-syntrophin 121224.XP_002429872 XP_002429872.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]