SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM457930-PA|EEB17230.1|U520 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM457930-PA|EEB17230.1|U520
Domain Number 1 Region: 1003-1175
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.8e-54
Family Sec63 N-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1834-1998
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.68e-54
Family Sec63 N-terminal domain 0.000000244
Further Details:      
 
Domain Number 3 Region: 1207-1499
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.51e-48
Family Tandem AAA-ATPase domain 0.00071
Further Details:      
 
Domain Number 4 Region: 669-881
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-47
Family Tandem AAA-ATPase domain 0.00075
Further Details:      
 
Domain Number 5 Region: 413-659
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-45
Family Tandem AAA-ATPase domain 0.00038
Further Details:      
 
Domain Number 6 Region: 1507-1716
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-39
Family Tandem AAA-ATPase domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1999-2086
Classification Level Classification E-value
Superfamily E set domains 6.72e-29
Family Sec63 C-terminal domain-like 0.0000106
Further Details:      
 
Domain Number 8 Region: 1716-1817
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000843
Family CAP C-terminal domain-like 0.089
Further Details:      
 
Domain Number 9 Region: 881-985
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000299
Family Restriction endonuclease FokI, N-terminal (recognition) domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM457930-PA|EEB17230.1|U520
Sequence length 2114
Comment putative|DS235802.1:7159:15339:-1|gene:PHUM457930
Sequence
MADAAARQLQYEYKANSNLVLQADVRLIERRSRDEATGEVMSLVGKLDGTRMGDRFQRSK
PVKAEERKAKRQKRDEAQYDFARMKGATLLSEGVDEMVGIIYRPKTQETRQTYEVLLSFI
QEALGDQPRDILCGAADEILQVLKNDRLKEREKKKETELLLGSVADERFALLVNLGKKIT
DFGSEEKTKEIIDEANIDETYGINVQFEESEEESNEDVFGEVREDEDLEEEGEDSKVDSA
IRAENLGVTEEMKKEKSLHPLDIDAYWLQRCLSKIYDDAMISQAKAAEVLAVLKNAGDDR
ETENQLVLLLGYNCFDFIKLLKKHRHMISYCTLLASSQSESERQKIRDEMNEIPALARIL
RQLDTGKGEDEVQEESGISRTTRRKEQTDDGKGNIQGSRQIVDLEELTFSQGSHFMANKR
CQLPDGSFRKQRKGYEEVHVPALKPKPFASEESLVPIEKLPKYVQPAFEGFKTLNRIQSR
LYKTALESDENVLLCAPTGAGKTNVALLCMMREIGKHIDHEGNIMGDEFKIIYIAPMRSL
VQEMVGNFNKRLHSYNLVVSELTGDHQLNRQQIQSTHIIVCTPEKWDIITRKGGDKTFTQ
LVRLIIIDEIHLLHDERGPVLEALVARTIRKIEAAQEDVRLVGLSATLPNYQDVATFLRV
KTETGLFYFDNSFRPVALEQQYIGVTEKKALKRFQVMNEIVYEKVMEHAGRNQVLVFVHS
RKETGKTARAIRDMCLEKDTLGQFLREGSASMEVLRTEAEQVKNSELKDLLPYGFAIHHA
GMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELGAL
DVLQMLGRAGRPQYDTKGEGILITNHSELQYYLSLLNQQLPIESQLVGKIPDMLNAEIVL
GTIQTVRDAVTWLGYTYLYIRMLRSPTLYGISHDHLKEDPLLESFRADLIHTAALQLDRS
GLIKYDRKTGHFQVTELGRICSHYYCTHETMAVYNQLLKPTLSEIELFRVFSLSGEFRNI
NVREEEKLELQKLMERVPIPIKENIEEPSAKVNVLLQAYISQLKLEGFALMSDMIYVTQS
AARLMRAIFEIVLFRGWAQLADKCLSLCKMIDRRMWQSMSPLRQFRKMPEEIIKKIEKKN
FPWERLYDLGPNEIGELIRVPKLGKTVHKYVHQFPKLELSTHIQPITRSTLRVELTITPD
FQWDEKLHGSSEAFWILVEDVDSEVILHHEYFLLKSKFASDEHLVKFFVPVFEPLPPQYF
LRIVSDRWIGAETQLPVSFRHLMLPEKNLPSTELLDLQPLPVTALRNSLYESIYSKKFPQ
FNPIQTQVFNAVYNTDDNIFIGAPTGSGKTTIAEFAVLRLLSQNPDGRCVYLVAKDSLAE
LIFAEWQQIFNCILNVKVVLLTGETSTDLKLLAKGQIIITTAEKWDVLSRRWKQRKNVQN
IQLFIVDELQLIGGEDGPVLEVVCSRMRYISSQLEKQIRIVALSTSLADARDVSQWLGCN
SNATFNFHPSVRPVPLELHVQGFNITHNASRLIAMSKPVFNNIMKHSSHKPVIVFVPTRK
QARITAISLLTFAAAESQPNRFFHAEEEDIQPFLERMSDKTLKETLIQGVAYIHEGLTPN
DHRLVEQLFDSGAVQIAVVTRNLCWGLNIQAHLVIIMDTQFYNGKIHAYEDYPVTDVLQM
IGKANRPLEDDDAKCVLMCQSSKKDFFKKFLNESLPVESHLDHRLHDHFNAEIVTKTIEN
KQDAVDYLTWTFLYRRLTQNPNYYNLQGVTHRHLSDHLSELVETTLNDLEQSKCISIEDE
MDCMPLNLGMIAAYYYINYTTIELFSLSLNSKTKIRGLLEIISSAAEYEDIPVRHREDTI
LRTLSMKLPNKLNSNTKFNDPHVKTNILLQAHLSRIQLSPDLQRDTEIILGKAVRLIQAC
VDVLSSNGWLAPAVAAMELAQMVTQAMWSKDSYLKQLPHFTSEIIKRCSEKNVETVFDIM
ELEDDDRIKLLQLSDSQMVLLEREDDVSGPVIAPFFPQKREEGWWVVIGDPKTNSLLSIK
RLTLQQKAKVKLDFIAPNPGHHSYTLYFMSDAYLGCDQEYKFSINVGEFESSTKDSTSKH
YNAFKPWKNFDNKL
Download sequence
Identical sequences E0VV24
XP_002429968.1.24195 vb|PHUM457930-PA|EEB17230.1|U520 121224.XP_002429968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]