SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM459000-PA|EEB17268.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM459000-PA|EEB17268.1|protein
Domain Number 1 Region: 189-398
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-51
Family DBL homology domain (DH-domain) 0.00000725
Further Details:      
 
Domain Number 2 Region: 385-556
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-29
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 593-706
Classification Level Classification E-value
Superfamily SH2 domain 1.24e-19
Family SH2 domain 0.00082
Further Details:      
 
Domain Number 4 Region: 5-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.51e-18
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM459000-PA|EEB17268.1|protein
Sequence length 732
Comment vav, putative|DS235803.1:26415:31121:-1|gene:PHUM459000
Sequence
MCARIEPWRECADWLTRCGILRSDHIANGAEAKARDLAVTLRDGVILCNLLNDIEPGCID
TKDVSQKPRLSQVFRVTTFFFLQTSHDTFGLKESDLFDPVVLFDLTDFVKVLQTLSKLSL
SPKFKKKNISGFSLIKHRSSHDELYKDLIHSNVLRAEDAEYSSHHVNMRNEEIYHDLCSI
NRISLQQIPSALPASLEKRDYVINELIETERNYLDVLGGLQRSFMRPLASIIREEDFKII
FAHIKELYEIHGVFLTQLRKAASPHGKIRLSEVFLSFREKFLIYGDYIANLTNAQNLIQD
LCGRSEMINNEVENCQQEANNGKFKLRDILSVPMQRILKYHLLLDKLVSETQMNHEDYRG
LERAKEAMVDVAQYINEVKRDSDALAILAYIEQSISDWHMPPDFTLKDYGRLILDGELRI
KAHNDQKQKVRYVFVFDRVMVMCKALKTILGDQYCYRESLRLDEYKIQDIEKKILTRDAR
WSYQWYLVHRAELTAYTCYSRTEEFKKKFMNAISEALDNIEPSVCRNTEHNFKMFTFESP
TTCSHCSKFLKGKIYQGYQCEKCHINCHKICIPYCGRCGSTKVPQLPPPRLHFNELKDCL
WFVGEMGRKTATSLLENEMDGTYLLRIRPQRPTNPSETIYAISLKTNEKVKHMKVYEENV
EGTLSYYLSLSRFFKSIIELITYYQHVSLEENFVGLDVKLQWPFSKNLTFTNEMDFSTAE
SNRLLPRADCRV
Download sequence
Identical sequences E0VV62
XP_002430006.1.24195 vb|PHUM459000-PA|EEB17268.1|protein 121224.XP_002430006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]