SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM459060-PA|EEB17274.1|oxysterol from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM459060-PA|EEB17274.1|oxysterol
Domain Number 1 Region: 349-733
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.12e-122
Family Oxysterol-binding protein 0.0000357
Further Details:      
 
Domain Number 2 Region: 117-241
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-21
Family Pleckstrin-homology domain (PH domain) 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM459060-PA|EEB17274.1|oxysterol
Sequence length 875
Comment binding protein, putative|DS235803.1:74673:78712:-1|gene:PHUM459060
Sequence
MNASTQQSPGVDFKRTHNDSTSSSHDLSNKTTPVNRTPEKKPQRRSLQFFLPKLPSSESI
NMASNTPSPNILTPNSALESSPHLSASKLARKESYKAQRKNYRQEKKRVADELLNSLKDP
SVIVLADWLKVRGTLKSWTKLWCILKPGLLLLYKSPKIKSNHWVGTVVLNACSIIERPSK
KDGFCFKLFHPMEQSIWAPRGPEKETIGAVVQPLPTSYLIFRAPSQQAGKCWLDALELSV
RCSTLLVRSFSRPSHVQTSDNDLTANHDTQWSEADFEKHFVDHDSDAGGGDRNSGTEQMS
VSESDSEVSAKFEEQTDLPEHEDPPETEYIQKEEGDVACSQGEQVEELAEENKSLIWFLV
KQVRPGMDLSKVVLPTFILEPRSFLDKLADSYYHADILSKAVLEDDAFTRMKIVVQWYLS
GFYKKSKGLKKPYNPILGESFRCFWKHPNGSRTFYIAEQVSHHPPVSAFYVTNRQDGFSI
SGSILAKSKFYGNSTSAILDGVAILTLLPRGEEYSITVPYALCKGILVGTLSMELGGKIS
IECEKTGYKTELEFKLKPLIGGSDQINGISGKLKLGKETLATIDGYWDGLTNIKDKRTGE
EQVLWHPTPTIRSTRLKRFTVPLNSQESYESEKLWEKVSAAILSDDQVAATEEKTALENA
QRNSAKSRKESGTEWIPKYFEQNLISGAWVYKHCDLRPWDPRNDLIQYEYNYIILTKTRH
RTPMIRTSSIVSVEPSSVQPLLQTESRSSLSVLKSSKRRITSKAKRQESVSSSQDGELHS
DSSQWGNNTTNTTRHNKIDDRIMDKMKGLEQVLKMNSDKLMKIQQNMETLGKMQRERDRK
LLNRPPSLFNMEILWALALISAFQLVAMWFLLKKG
Download sequence
Identical sequences E0VV68
XP_002430012.1.24195 vb|PHUM459060-PA|EEB17274.1|oxysterol 121224.XP_002430012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]