SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM459660-PA|EEB17295.1|Nuclear from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM459660-PA|EEB17295.1|Nuclear
Domain Number 1 Region: 58-158
Classification Level Classification E-value
Superfamily Histone-fold 1.71e-40
Family TBP-associated factors, TAFs 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM459660-PA|EEB17295.1|Nuclear
Sequence length 192
Comment transcription factor Y subunit beta, putative|DS235804.1:55603:56526:1|gene:PHUM459660
Sequence
MISVMEASESGDDLGGAAFLTDGVYTVHDDVDGNLSAENTDDDTNDTKEKVGAPLREQDR
FLPIANVAKIMKKAVPELGKIAKDARECVQECVSEFISFITSEASDRCHMEKRKTINGED
ILFAMTTLGFDNYVEPLKIYLQKYREATKGDRPTIEEIYENKVFSAGVIPDNSNSDTILY
AYPEQIQHFQIQ
Download sequence
Identical sequences E0VV89
XP_002430033.1.24195 vb|PHUM459660-PA|EEB17295.1|Nuclear 121224.XP_002430033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]