SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM462860-PA|EEB17358.1|myosin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM462860-PA|EEB17358.1|myosin
Domain Number 1 Region: 59-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-280
Family Motor proteins 0.000000000119
Further Details:      
 
Domain Number 2 Region: 1968-2084
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-23
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 1263-1366
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-21
Family First domain of FERM 0.026
Further Details:      
 
Domain Number 4 Region: 2085-2175
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-21
Family Third domain of FERM 0.013
Further Details:      
 
Domain Number 5 Region: 1868-1976
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.44e-17
Family First domain of FERM 0.08
Further Details:      
 
Domain Number 6 Region: 1358-1455
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000236
Family Second domain of FERM 0.008
Further Details:      
 
Domain Number 7 Region: 1580-1650
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000353
Family SH3-domain 0.0029
Further Details:      
 
Domain Number 8 Region: 810-877
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000023
Family Motor proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM462860-PA|EEB17358.1|myosin
Sequence length 2188
Comment VII, putative|DS235811.1:116976:125564:1|gene:PHUM462860
Sequence
MVAHSILLLGTAFNKNNFYNHFKFIKTYGDYIWIEPVTGREFDVAIGARVVSAEGRRIQV
KDDDSKEQWLTPERRIKAMHATSVQGVEDMISLGDLHEAGILRNLLIRYNENLIYTYTGS
ILVAVNPYQILPIYTAEQIKLYKDKKIGELPPHIFAIGDNAYTHMKRYGHDQCIVISGES
GAGKTESTKLILQYLAAISGKHSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKYIDIH
FNSQGVIEGAKIEQYLLEKSRIVSQNTDERNYHVFYCILAGLTKEEKQKLDLGEPNQYRY
LTGGGSTTCEGRDDAAEFADIRSAMKVLLFSDQEIWEILKLLAALLHTGNIKYKAAVIDN
LDATEIPDHSNVERVAGLLGVPLQPLISALTRKTIFANGETVISTLSRDQSVDVRDAFVK
GIYGRLFIFIVKKINSAIYKPRGSTRSAIGVLDIFGFENFNTNSFEQFCINYANENLQQF
FVQHIFKLEQEEYNIEGINWQHIEFVDNQDSLDLIAIKQLNIMALIDEESKFPKGTDQTM
LAKLHKTHSSHRNYLKPKSDINTSFGLNHFAGIVFYDTRGFLEKNRDTFSADLLQLVHMS
NNKFLQSIFAEDIGMGSETRKRTPTLSTQFKKSLDSLMKTLSSCQPFFIRCIKPNEYKKP
MMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHSFKEFVERYRFLIPGIPPAHKGDCRTAT
TKICQAVLGRSDYQLGHNKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFIK
MKNAAMTIQKYWKGWAQRRRYQRMRGGYMRLQALIRSRVLSHRFRHLRGHVVALQARIRG
YLIRRMFKTKIWAIIKIQAHVRRMIAQKRYKKIKYDYRHHLEALRLRKLEERELKEAGNK
RAKEIAEQNYRKRMKELERKEIELEMEERRQMEIKKNLINDAAKKQDEPVDDSKLVEAMF
DFLPDSSSEAPTSTRETSVFNDLPSPKADPHEIISPMHVPSEDEEDLSEFKFHKFAATYF
QGNMTHQYSRKPLKHSLLPLHTQGDQLAAQALWITILRFTGDLAEPRCHTMDRDTTSVMS
KVTATLGRNFIRSKEFQEAQMMGLDPDSFMKQKPRSIRHKLVSLTLKRKNKLGEDVRRRL
QEDEYTADSYQHWLESRPTTNLEKLHFIIGHGILRAELRDEIYCQICKQLTANPSKSSHA
RGWILLSLCVGCFSPSEKFVNYLRAFIREGPPGYAPYCEDRLKRTFNNGTRNQPPSWLEL
QATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKIGLKDQFGFSLYIALFDKV
SSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIFAPWHEPTDDQVATNLIYQ
QVVRGVKFGEYRCDKEEDLAMIAAQQYYIEYGTDMNVERLFTLLQSYIPDYCLTNNEKSV
DRWAQLIVMAYKKSYYLKEKVVALRVKEDVVSYAKFKWPLLFSRFYEAYRNSGPNLPKND
VIIAVNWTGVYVVDDQEQVLLELSFPEIMTVASQKTNKVFTQTFTLSTVRAEEFTFQSPN
AEDIRDLVVYFLEGLKKRSKFVIALQDYRAPGESSSFLSFERGDLIILEDESTGEAVMNS
GWCVGRCERTNEKGDFPAETVYVIPCLNKPPSDILALFSLESTENGRRVNHQHMNGNDNQ
ERPHNLLEYALDHFRPPPKRTVSKTLTLSSARKGPPDELWRHSRDPIKQPLLKKLLCKDE
LSEEACYAFTAVLKYMGDLPSKRPRITNEYTDQIFDGPLKHEILRDEIYCQIMKQLTDNR
NRISEERGWELMWLATGLFACSQNLLKELSMFLRTRRHPISQDSFQRLQKTLRNGQRKYP
PHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTKAKDFCHNISQRLNLRSSEGFSLF
VKIADKVISVPEGDFFFDFVRHLTDWIKKARPSRDGTTPQFTYQVFFMKKLWTNTVPGKD
RNADIIFHYHQELPKLLRGYHKCTKEEASRLAALAYRVRFGESKQELQTIPQRLRDLLPS
DLIKAQSANDWKRSIVTSYNQDAGMSSEDAKITFLKITYRWPTFGSAFFEVKQTTEPNYP
ELLLIAINKHGVSLIHPQTKEILVTHPFTRISNWSSGNTYFHMTIGNLVRGSKLLCETSL
GYKMDDLLTSYISLMLSNINKQKSLRIK
Download sequence
Identical sequences E0VVF2
vb|PHUM462860-PA|EEB17358.1|myosin 121224.XP_002430096 XP_002430096.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]