SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM465010-PA|EEB17424.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM465010-PA|EEB17424.1|Sorting
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily PX domain 3.53e-21
Family PX domain 0.0015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM465010-PA|EEB17424.1|Sorting
Domain Number - Region: 121-191
Classification Level Classification E-value
Superfamily TPR-like 0.00387
Family Tetratricopeptide repeat (TPR) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM465010-PA|EEB17424.1|Sorting
Sequence length 249
Comment nexin-20, putative|DS235812.1:258737:259637:1|gene:PHUM465010
Sequence
MRTKFDIVSARTVDDKENQKKYVVYDIKIYHQGSDNDTQAIFVERRYSDFLELFLNLRQN
YPQLTTKISFPRKVLIGNFSSDLIQTRLSSLENFLRIISENVTLLESLGFKMFLIGNDDK
LAKKYLFNKKYYEAKPLLENNFKILNKIHTERHPAVIVALCRLAACCTADTNLLEDAIKY
SEIAIRRFDGISDVDLLYYYIPLLQMCSYLWEITGKDKGILESRLSSLKLRGHRVDGCPS
LLESILNID
Download sequence
Identical sequences E0VVL8
121224.XP_002430162 vb|PHUM465010-PA|EEB17424.1|Sorting XP_002430162.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]