SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM473040-PA|EEB17580.1|multiple from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM473040-PA|EEB17580.1|multiple
Domain Number 1 Region: 173-520
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.65e-86
Family Ankyrin repeat 0.00000296
Further Details:      
 
Domain Number 2 Region: 1370-1702
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-80
Family Ankyrin repeat 0.0000103
Further Details:      
 
Domain Number 3 Region: 470-659
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.14e-47
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 2049-2118
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM473040-PA|EEB17580.1|multiple
Sequence length 2803
Comment ankyrin repeats single kh domain protein, putative|DS235816.1:177423:191031:-1|gene:PHUM473040
Sequence
MQNVAQGSSSDSQKIEKGNAHHDTEKSSTPQSSNSSPTKSGTETFSELQPKFMTDSSESE
EDDVSEVESFMIEQELDEDSRLDTSKFLLSGGCAEGAENSVDPETQARLEALLEAAGISK
LSTGDGKQLADPEVLRRLTSSVSCALDEAAAALTRMRTENPRSQVELVPTRSLVEACTDG
DVSTVRKLLTEGKSVHETTEEGESLLSLACSAGYLELAQVLLAMHANVEDRGVKGDCTPL
MEAASAGHPDIVKLLINHGAEVNAQSSSGNTPLMYACAGGHEAVVRVLLENEANVEDHNE
NGHTPLMEAASAGHVGVAKILLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGA
DQEHKTDEMHTALMEASMDGHVEVARLLLDSGAQVNMPTDSFESPLTLAACGGHTELALL
LIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGANINAQTEETQETALTLACCGG
FLEVADFLLKAGADLELGASTPLMEAAQEGHLELVRYLLEYYHANVNAQTQTGDTALTYA
CENGHTEVATLLLMYGAELEHESEGGRTPLMKACRAGHQQTVQFLISKNADVNKTTTNND
HTPLSLAAAGGHIGVVELLLAHHADPFHKLKDNSTILIEAAKGGHTNVVHLLLDYPHSIM
MQPPAVPPQPSEDLLREYDAARAAAAAAIAREAEQNGQNNKVPLHCANKPHNPQKALSLL
RKIKLPTTSEPGLTSSEAQQVRTQPVGENASNLNHSVPESEVNVQNKGSTSGVSNKEEKE
KKDVTVSTATLVPGPKPLVLNIDLPSQQNVAIGGNGKVVVPTQPSSPPQPPQMSLPNSPP
QQPFEVTQITAISDRPKAKPVSKKEGKNLRKINLQQQHLELQQLTQEFQQTQTQNQNQTS
QTQTSQVQDLRGITPTQLLAHLQQLDPAIATAATPSQLQLLQQKHQQLWTLQQQITPANS
VDVNELAGMLSDQSQPCHLFTTTEDMLDKMRQNVVADSLLIAAITSSQDGSDGKEDGKNL
SKTPAEQIDNIVMDFAHKLEAFRLEDSTIDQERLTAATQQELSAEEALAAEEEAFNLLAQ
QQPQDLAYITVPAISSQQNQRGNQTNHIQYQQFSTPHDIVTQNDVSTGLQMTGTSLQLSG
TNGQPMSLTRTNERAVQMSGTSTQSQISGSNSRQMDLFSAGFVAGLQSVNKARMSGNLPV
SGNVQQTAQNIQVGSGITPLHMANTSATHLMNLSARIDPGNAAFQSQSLFPSPLSRNVTT
CESSTSTTQFSCPITTEANTTRQVQVATQTVTEKKVSHTQSAYLPIKGKKARYQIPLRQH
NSNFTSHQLDANSGIGHYPQPSNAAQCQQTTPPVLHPPIQLSSGMDVDSETDTNHDTALT
LACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHEKVVDILLNHGADIEAQSER
TKDTPLSLACSGGRYEVVELLLTKMANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAE
INSRTGSKLGISPLMLAAMNGHTTAVRILLDMGSDINAQIETNRNTALTLACFQGRHEVV
SLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAA
DKGHCRFVELLLSRNAMVEVKNKKGNSPLWLAANGGHLNVVELLYNLDADIDSQDNRKVS
CLMAAFRKGHVKVVKWMVNHVTQFPSDQDMTRFIATVNDKELLEKCHECVKLIRAAKDLQ
SAKANKNASILLEELDMEKTREESKKAAAARRRERKKKKKLEKKEEKRKLINENKKNEKI
PSDNEDEEEEEEAEKSDIEEISPKVTYTKEKEMNKESKNNNDVRLNSSSPLRNGEALDKE
EGDSGIDANSQGSCSSNDVKSKEKRKDKKKKKGNQGERDKSNSNSNEASVNSESSSTVTN
SKPNVGTKELSERRHKGGESITHENGTNNIPNLSHSENKNNGGTVRSSEKKSNKGSLVFE
SSRHPADREDFEATGNETYILGNKSRKSNNYVNHFETENVTSNKNQNSSTSPKGCGKREE
GWKEVVRKSKKVSVPLNAISRVIGRGGSNINAIRSATGAHIEVEKQGKGQGERIITIKGS
ADATKQAHNLIAVLIKDPDVDILQMLPKPAKSSAIATSSTDKVTISVANKTKHTTLPKLL
PRIGTQSVSVVNKTSVTPSTSVRSTAPTKLVYSTTVSKSTAPRLISVSEKRSSGNTQLTP
NTKTTMSYTSAIMTSGRNMKITPLASQTFAAKLSDSTLSTTVNTASVSMVGKSRTPIGSG
SMLTPSQPPATAPVSPQVSPHQQVLSSPKHHRPQPTVSAPPNIQGQFSSIAPFPQSSSVQ
SMSLMQQQSAVRSSTPIQHEIVNQNHIPQEYSLFNDSFSKSSMWGRENEQSQKLNFASVA
ATSSLSSAPPTNTSKFMEDIQTQTQVDVTKAPGYRGNAVCSPVSSKSNSNLPIMYSGGFP
DPPAPSLTVPNVRPSMEILSTNIGPIPPSQHVDIVPSPVGGPGPIGPPLFASRPNYQSTE
KSEQPLYTNVNSSTTFGQDLLKINPDNQLIGFTHQLNYSQQNSPPAPATNPTISMSRLNP
RAPDFSVSYAKQPQPQQQQQQQQQQQQQQQQLFHPQNNNPNMAVLALATTMNKQYPRSAA
NGQPRWPYGPIPQGYQPQLQEFTGMFTNHNVLPNTVELLSNFENGGIVNSPSMSPSSPAN
NPTGDHKIEDRKIPRPIGTERNWKNNQGHNAAFGMGPSGDMDPGNWLVEPKINWPGARSM
NPMFTGNPPPYRIPLPEELPQLIDSPFQTDNFITEILPHWLNN
Download sequence
Identical sequences E0VW24
XP_002430318.1.24195 vb|PHUM473040-PA|EEB17580.1|multiple 121224.XP_002430318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]