SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM474410-PA|EEB17608.1|Forkhead from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM474410-PA|EEB17608.1|Forkhead
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.62e-40
Family Forkhead DNA-binding domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM474410-PA|EEB17608.1|Forkhead
Sequence length 171
Comment box protein C2, putative|DS235817.1:336570:337388:-1|gene:PHUM474410
Sequence
MEYKNKKQLTTTDLNKITSLPEIIFDPYVMSSASRETHIKSLMNQHLIKLREKNFFFNTR
PEKPPYSYIALIAMAISSAPGKKITLSGIYRFIMDRFPYYRENKQGWQNSIRHNLSLNDC
FVKIPRNKSCSSGGKGSYWTLGPGAIDMFENGNYRRRRSKRQRGNQRQIQV
Download sequence
Identical sequences E0VW52
XP_002430346.1.24195 121224.XP_002430346 vb|PHUM474410-PA|EEB17608.1|Forkhead

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]